Cytochrome P450 26C1

Details

Name
Cytochrome P450 26C1
Synonyms
  • 1.14.-.-
Gene Name
CYP26C1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049799|Cytochrome P450 26C1
MFPWGLSCLSVLGAAGTALLCAGLLLSLAQHLWTLRWMLSRDRASTLPLPKGSMGWPFFG
ETLHWLVQGSRFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQS
AHILLGSHTLLGAVGEPHRRRRKVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVS
VYDASKALTFRMAARILLGLRLDEAQCATLARTFEQLVENLFSLPLDVPFSGLRKGIRAR
DQLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHEPSMQELKESAVELLFAAFFT
TASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPPDCGCEPDLSL
AALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAV
YRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTA
RWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
Number of residues
522
Molecular Weight
57110.385
Theoretical pI
Not Available
GO Classification
Functions
heme binding / iron ion binding / retinoic acid 4-hydroxylase activity / retinoic acid binding
Processes
anterior/posterior pattern specification / central nervous system development / negative regulation of retinoic acid receptor signaling pathway / neural crest cell development / organelle fusion / oxidation-reduction process / retinoic acid catabolic process / sterol metabolic process / vitamin metabolic process
Components
endoplasmic reticulum membrane / integral component of membrane
General Function
Plays a role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA (preferred substrate).
Specific Function
Heme binding
Pfam Domain Function
Transmembrane Regions
9-29
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0049800|Cytochrome P450 26C1 (CYP26C1)
ATGTTCCCTTGGGGGCTGAGCTGCCTGTCAGTGCTGGGGGCGGCGGGCACTGCTCTCCTG
TGCGCGGGCCTGCTGCTCAGCCTGGCCCAGCACCTCTGGACCCTCCGCTGGATGCTGAGC
CGGGACCGGGCCTCCACCCTGCCTCTGCCCAAGGGCTCCATGGGGTGGCCCTTCTTCGGC
GAAACGCTGCACTGGTTAGTTCAGGGCTCGCGCTTCCACAGTTCTCGCCGAGAGCGCTAT
GGGACAGTGTTCAAGACGCACCTGCTGGGCAGGCCAGTGATCCGCGTGAGCGGCGCGGAG
AACGTGCGCACCATCCTGCTGGGCGAGCACCGCCTGGTGCGCAGCCAGTGGCCGCAGAGT
GCGCACATCCTGCTGGGCTCGCACACACTGCTAGGTGCGGTCGGCGAGCCGCACCGGCGG
CGGCGCAAGGTCCTGGCGCGCGTGTTCAGCCGCGCCGCGCTGGAGCGCTACGTGCCGCGC
CTGCAGGGGGCGCTGCGGCATGAGGTGCGCTCCTGGTGCGCGGCGGGCGGGCCGGTCTCA
GTCTACGACGCCTCCAAAGCGCTCACCTTCCGCATGGCCGCGCGCATCCTGCTGGGGTTG
CGGCTGGACGAGGCGCAGTGCGCCACGCTGGCCCGGACCTTCGAGCAGCTCGTGGAGAAC
CTCTTCTCACTGCCTCTGGACGTTCCCTTCAGTGGCCTACGCAAGGGCATCCGGGCAAGG
GACCAGCTGCATCGGCACCTGGAGGGGGCCATTTCTGAGAAGCTTCACGAGGACAAGGCT
GCAGAGCCGGGTGATGCCCTCGACCTAATCATTCACAGTGCAAGGGAGCTGGGCCATGAG
CCCTCCATGCAGGAGCTGAAGGAGTCGGCTGTGGAGCTCCTCTTCGCCGCCTTCTTCACC
ACGGCCAGTGCCAGCACCTCGCTCGTCCTGCTGCTACTGCAGCATCCGGCGGCCATCGCC
AAGATTCGGGAGGAGCTGGTGGCGCAGGGGCTGGGGCGCGCGTGCGGCTGCGCGCCCGGG
GCCGCTGGGGGCAGCGAGGGGCCCCCGCCCGACTGCGGCTGCGAGCCCGACCTCAGCCTC
GCGGCGCTGGGCCGTCTGCGCTACGTCGACTGCGTGGTCAAGGAGGTGCTGCGCCTCCTG
CCGCCAGTGTCCGGGGGCTACCGCACCGCCCTGCGCACCTTCGAGCTCGACGGCTACCAG
ATCCCCAAGGGCTGGAGCGTGATGTATAGCATCCGGGACACGCACGAGACGGCTGCGGTG
TACCGCAGCCCTCCCGAAGGCTTCGATCCAGAGCGCTTCGGCGCAGCGCGCGAAGATTCC
CGGGGCGCCTCCAGCCGCTTCCATTACATCCCGTTCGGCGGCGGTGCGCGCAGCTGCCTC
GGCCAGGAGCTGGCGCAAGCCGTGCTCCAGCTGCTAGCTGTGGAGCTAGTGCGCACCGCG
CGCTGGGAACTGGCCACACCCGCCTTCCCCGCCATGCAGACGGTGCCCATCGTGCACCCA
GTGGACGGGCTGCGGCTCTTTTTCCACCCCCTCACGCCTTCGGTTGCGGGGAATGGGCTA
TGCCTCTGA
Chromosome Location
10
Locus
10q23.33
External Identifiers
ResourceLink
UniProtKB IDQ6V0L0
UniProtKB Entry NameCP26C_HUMAN
HGNC IDHGNC:20577
General References
  1. Taimi M, Helvig C, Wisniewski J, Ramshaw H, White J, Amad M, Korczak B, Petkovich M: A novel human cytochrome P450, CYP26C1, involved in metabolism of 9-cis and all-trans isomers of retinoic acid. J Biol Chem. 2004 Jan 2;279(1):77-85. Epub 2003 Oct 7. [PubMed:14532297]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  3. Slavotinek AM, Mehrotra P, Nazarenko I, Tang PL, Lao R, Cameron D, Li B, Chu C, Chou C, Marqueling AL, Yahyavi M, Cordoro K, Frieden I, Glaser T, Prescott T, Morren MA, Devriendt K, Kwok PY, Petkovich M, Desnick RJ: Focal facial dermal dysplasia, type IV, is caused by mutations in CYP26C1. Hum Mol Genet. 2013 Feb 15;22(4):696-703. doi: 10.1093/hmg/dds477. Epub 2012 Nov 16. [PubMed:23161670]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00523Alitretinoinapproved, investigationalunknownDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownDetails