Possible cellulase CelA1 (Endoglucanase) (Endo-1,4-beta-glucanase) (FI-cmcase) (Carboxymethyl cellulase)

Details

Name
Possible cellulase CelA1 (Endoglucanase) (Endo-1,4-beta-glucanase) (FI-cmcase) (Carboxymethyl cellulase)
Synonyms
  • CARBOXYMETHYL CELLULASE
  • EC 3.2.1.4
  • ENDO-1,4-BETA-GLUCANASE
  • ENDOGLUCANASE
  • FI-CMCASE
Gene Name
celA1
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0011779|Possible cellulase CelA1 (Endoglucanase) (Endo-1,4-beta-glucanase) (FI-cmcase) (Carboxymethyl cellulase)
MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMSSAIGSVARWIVPLLG
VAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTS
VANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATG
TDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAA
VYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHY
VIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGE
PQAGRFVSQYAIDLAHNAGQ
Number of residues
380
Molecular Weight
39973.515
Theoretical pI
8.2
GO Classification
Functions
cellulase activity
Processes
cellulose catabolic process
Components
extracellular region / integral component of membrane
General Function
Cellulase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
51-71
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0011780|Possible cellulase CelA1 (Endoglucanase) (Endo-1,4-beta-glucanase) (FI-cmcase) (Carboxymethyl cellulase) (celA1)
ATGACGCGTCGGACTGGGCAGCGATGGCGCGGGACTCTGCCCGGGCGCCGGCCTTGGACA
CGGCCAGCGCCCGCCACCTGTCGTCGGCATTTGGCGTTTGTCGAATTGCGGCATTATTTT
GCTCGGGTGATGTCATCAGCTATTGGTTCGGTCGCGCGGTGGATAGTCCCCCTCCTGGGG
GTTGCAGCCGTTGCTTCCATCGGTGTTATCGCGGACCCGGTGCGGGTCGTTCGGGCCCCG
GCGTTGATCCTGGTCGATGCGGCAAACCCGCTGGCCGGAAAGCCCTTCTACGTCGATCCC
GCCTCGGCGGCCATGGTCGCCGCGCGCAACGCCAACCCGCCGAACGCCGAGCTGACCTCC
GTCGCCAACACCCCGCAGTCCTACTGGCTCGACCAGGCATTCCCGCCGGCGACCGTCGGC
GGCACGGTTGCCAGGTACACCGGAGCGGCGCAGGCGGCCGGCGCCATGCCGGTTCTGACG
CTGTATGGAATCCCCCATCGCGACTGCGGTAGCTACGCATCCGGTGGGTTCGCGACGGGC
ACTGATTACCGCGGGTGGATCGACGCTGTCGCATCCGGCCTGGGCTCATCGCCGGCGACG
ATCATCGTCGAACCCGATGCGCTGGCCATGGCCGACTGCCTGTCGCCTGACCAGCGCCAG
GAACGTTTCGACTTGGTGCGCTACGCCGTCGACACGCTGACCCGCGACCCGGCCGCTGCC
GTGTACGTCGATGCGGGGCATTCGCGCTGGCTGAGCGCCGAGGCAATGGCCGCCAGGCTC
AACGATGTCGGTGTGGGCCGCGCGCGCGGGTTTAGCCTCAACGTCTCGAACTTCTACACC
ACCGATGAGGAAATCGGCTATGGCGAGGCGATTTCGGGGCTCACGAACGGTTCGCATTAC
GTGATCGACACGTCGCGCAACGGCGCCGGACCCGCGCCCGACGCCCCGCTCAACTGGTGT
AACCCCAGCGGCCGCGCCCTGGGCGCACCGCCCACCACGGCGACCGCGGGCGCGCACGCC
GACGCTTACCTGTGGATCAAACGTCCCGGGGAATCGGACGGAACCTGCGGTCGCGGGGAG
CCTCAGGCGGGTCGGTTCGTTAGCCAGTACGCCATCGATCTGGCCCACAACGCCGGCCAG
TAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ79G13
UniProtKB Entry NameQ79G13_MYCTU
GenBank Gene IDBX842572
General References
  1. Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [PubMed:9634230]
  2. Varrot A, Leydier S, Pell G, Macdonald JM, Stick RV, Henrissat B, Gilbert HJ, Davies GJ: Mycobacterium tuberculosis strains possess functional cellulases. J Biol Chem. 2005 May 27;280(21):20181-4. Epub 2005 Apr 11. [PubMed:15824123]
  3. Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [PubMed:21969609]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01642methyl beta-D-glucopyranosideexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB02467L-methionine (S)-S-oxideexperimentalunknownDetails
DB035844-Thio-beta-D-glucopyranoseexperimentalunknownDetails
DB04545Afegostatexperimental, investigationalunknownDetails