Penicillin-binding protein 1b

Details

Name
Penicillin-binding protein 1b
Synonyms
Not Available
Gene Name
pbp1b
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Amino acid sequence
>lcl|BSEQ0022105|Penicillin-binding protein 1b
MQNQLNELKRKMLEFFQQKQKNKKSARPGKKGSSTKKSKTLDKSAIFPAILLSIKALFNL
LFVLGFLGGMLGAGIALGYGVALFDKVRVPQTEELVNQVKDISSISEITYSDGTVIASIE
SDLLRTSISSEQISENLKKAIIATEDEHFKEHKGVVPKAVIRATLGKFVGLGSSSGGSTL
TQQLIKQQVVGDAPTLARKAAEIVDALALERAMNKDEILTTYLNVAPFGRNNKGQNIAGA
RQAAEGIFGVDASQLTVPQAAFLAGLPQSPITYSPYENTGELKSDEDLEIGLRRAKAVLY
SMYRTGALSKDEYSQYKDYDLKQDFLPSGTVTGISRDYLYFTTLAEAQERMYDYLAQRDN
VSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRV
EVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSE
TILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYME
KMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEY
QDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDEN
MWLMLSTPRLTLGGWIGHDDNHSLSRRAGYSNNSNYMAHLVNAIQQASPSIWGNERFALD
PSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQ
NAWSSIVGSLPTPSSSSSSSSSSSDSSNSSTTRPSSSRARR
Number of residues
821
Molecular Weight
89479.92
Theoretical pI
8.82
GO Classification
Functions
penicillin binding / peptidoglycan glycosyltransferase activity / transferase activity, transferring acyl groups
Components
integral component of membrane
General Function
Transferase activity, transferring acyl groups
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
60-84
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022106|Penicillin-binding protein 1b (pbp1b)
ATGCAAAATCAATTAAATGAATTAAAACGAAAAATGCTGGAATTTTTCCAGCAAAAACAA
AAAAATAAAAAATCAGCTAGACCTGGCAAGAAAGGTTCAAGTACCAAAAAATCTAAAACC
TTAGATAAGTCAGCCATTTTCCCAGCTATTTTACTGAGTATAAAAGCCTTATTTAACTTA
CTCTTTGTACTCGGTTTTCTAGGAGGAATGTTGGGAGCTGGGATTGCTTTGGGGTACGGA
GTGGCCTTATTTGACAAGGTTCGGGTGCCTCAGACAGAAGAATTGGTGAATCAGGTCAAG
GACATCTCTTCTATTTCAGAGATTACCTATTCGGACGGGACGGTGATTGCTTCCATAGAG
AGTGATTTGTTGCGCACTTCTATCTCATCTGAGCAAATTTCGGAAAATCTGAAGAAGGCT
ATCATTGCGACAGAAGATGAACACTTTAAAGAACATAAGGGTGTAGTACCCAAGGCGGTG
ATTCGTGCGACCTTGGGGAAATTTGTAGGTTTGGGTTCCTCTAGTGGGGGTTCAACCTTG
ACCCAGCAACTAATTAAACAGCAGGTGGTTGGGGATGCGCCGACCTTGGCTCGTAAGGCG
GCAGAGATTGTGGATGCTCTTGCCTTGGAACGCGCCATGAATAAAGATGAGATTTTAACG
ACCTATCTCAATGTGGCTCCCTTTGGCCGAAATAATAAGGGACAGAATATTGCAGGGGCT
CGGCAAGCAGCTGAGGGAATTTTCGGTGTAGATGCCAGTCAGTTGACTGTTCCTCAAGCA
GCATTTTTAGCAGGACTTCCACAGAGTCCCATTACTTACTCTCCTTATGAAAATACTGGG
GAGTTGAAGAGTGATGAAGACCTAGAAATTGGCTTAAGACGGGCTAAGGCAGTTCTTTAC
AGTATGTATCGTACAGGTGCATTAAGCAAAGACGAGTATTCTCAGTACAAGGATTATGAC
CTTAAACAGGACTTTTTACCATCGGGCACGGTTACAGGAATTTCACGAGACTATTTATAC
TTTACAACTTTGGCAGAAGCTCAAGAACGTATGTATGACTATCTAGCTCAGAGAGACAAT
GTCTCCGCTAAGGAGTTGAAAAATGAGGCAACTCAGAAGTTTTATCGAGATTTGGCAGCC
AAGGAAATTGAAAATGGTGGTTATAAGATTACTACTACCATAGATCAGAAAATTCATTCT
GCCATGCAAAGTGCGGTTGCTGATTATGGCTATCTTTTAGACGATGGAACAGGTCGTGTA
GAAGTAGGGAATGTCTTGATGGACAACCAAACAGGTGCTATTCTAGGCTTTGTAGGTGGT
CGTAATTATCAAGAAAATCAAAATAATCATGCCTTTGATACCAAACGTTCGCCAGCTTCT
ACTACCAAGCCCTTGCTGGCCTACGGTATTGCTATTGACCAGGGCTTGATGGGAAGTGAA
ACGATTCTATCTAACTATCCAACAAACTTTGCTAATGGCAATCCGATTATGTATGCTAAT
AGCAAGGGAACAGGAATGATGACCTTGGGAGAAGCTCTGAACTACTCATGGAATATCCCT
GCTTACTGGACCTATCGTATGCTCCGTGAAAATGGTGTTGATGTCAAGGGTTATATGGAA
AAGATGGGTTACGAGATTCCTGAGTACGGTATTGAGAGCTTGCCAATGGGTGGTGGTATT
GAAGTCACAGTTGCCCAGCATACCAATGGCTATCAGACCTTAGCTAATAATGGAGTTTAT
CATCAGAAGCATGTGATTTCAAAGATTGAAGCAGCAGATGGTAGAGTGGTGTATGAGTAT
CAGGATAAACCGGTTCAAGTCTATTCAAAAGCTACTGCGACGATTATGCAGGGATTGCTA
CGAGAAGTTCTATCCTCTCGTGTGACAACAACCTTCAAGTCTAACCTGACTTCTTTAAAT
CCTACTCTGGCTAATGCAGATTGGATTGGGAAGACTGGTACAACCAACCAAGACGAAAAT
ATGTGGCTCATGCTTTCGACACCTAGATTAACCCTAGGTGGCTGGATTGGGCATGATGAT
AATCATTCATTGTCACGTAGAGCAGGTTATTCTAATAACTCTAATTACATGGCTCATCTG
GTAAATGCGATTCAGCAAGCTTCCCCAAGCATTTGGGGGAACGAGCGCTTTGCTTTAGAT
CCTAGTGTAGTGAAATCGGAAGTCTTGAAATCAACAGGTCAAAAACCAGGGAAGGTTTCT
GTTGAAGGAAAAGAGGTAGAGGTCACAGGTTCGACTGTTACCAGCTATTGGGCTAATAAG
TCAGGAGCGCCAGCGACAAGTTATCGCTTTGCTATTGGCGGAAGTGATGCGGATTATCAG
AATGCTTGGTCTAGTATTGTGGGGAGTCTACCAACTCCATCCAGCTCCAGCAGTTCAAGT
AGTAGTTCTAGCGATAGCAGTAACTCAAGTACTACACGACCTTCTTCTTCAAGGGCGAGA
CGATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ7CRA4
UniProtKB Entry NameQ7CRA4_STRR6
GenBank Protein ID15457529
GenBank Gene IDAE007317
General References
  1. Hoskins J, Alborn WE Jr, Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ, Fuller W, Geringer C, Gilmour R, Glass JS, Khoja H, Kraft AR, Lagace RE, LeBlanc DJ, Lee LN, Lefkowitz EJ, Lu J, Matsushima P, McAhren SM, McHenney M, McLeaster K, Mundy CW, Nicas TI, Norris FH, O'Gara M, Peery RB, Robertson GT, Rockey P, Sun PM, Winkler ME, Yang Y, Young-Bellido M, Zhao G, Zook CA, Baltz RH, Jaskunas SR, Rosteck PR Jr, Skatrud PL, Glass JI: Genome of the bacterium Streptococcus pneumoniae strain R6. J Bacteriol. 2001 Oct;183(19):5709-17. [PubMed:11544234]
  2. Macheboeuf P, Di Guilmi AM, Job V, Vernet T, Dideberg O, Dessen A: Active site restructuring regulates ligand recognition in class A penicillin-binding proteins. Proc Natl Acad Sci U S A. 2005 Jan 18;102(3):577-82. Epub 2005 Jan 6. [PubMed:15637155]
  3. Contreras-Martel C, Amoroso A, Woon EC, Zervosen A, Inglis S, Martins A, Verlaine O, Rydzik AM, Job V, Luxen A, Joris B, Schofield CJ, Dessen A: Structure-guided design of cell wall biosynthesis inhibitors that overcome beta-lactam resistance in Staphylococcus aureus (MRSA). ACS Chem Biol. 2011 Sep 16;6(9):943-51. doi: 10.1021/cb2001846. Epub 2011 Aug 3. [PubMed:21732689]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08508N-BENZOYL-D-ALANINEexperimentalunknownDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnyesinhibitorDetails
DB00493CefotaximeapprovedyesinhibitorDetails
DB00319PiperacillinapprovedyesinhibitorDetails
DB00607Nafcillinapproved, investigationalyesinhibitorDetails
DB00415Ampicillinapproved, vet_approvedyesinhibitorDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB01163Amdinocillininvestigational, withdrawnyesinhibitorDetails
DB01603Meticillinapproved, investigationalyesinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedyesinhibitorDetails
DB00713Oxacillinapproved, investigationalyesinhibitorDetails
DB01331CefoxitinapprovedyesinhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedyesinhibitorDetails
DB03313Cephalosporin CexperimentalyesinhibitorDetails
DB08795AzidocillinexperimentalyesinhibitorDetails
DB00739Hetacillinapproved, vet_approved, withdrawnyesinhibitorDetails