Transketolase

Details

Name
Transketolase
Synonyms
  • 2.2.1.1
Gene Name
tkt2
Organism
Bacillus anthracis
Amino acid sequence
>lcl|BSEQ0017401|Transketolase
MSHSIEQLSINTIRTLSIDAIEKANSGHPGMPMGAAPMAYTLWTQFMKHNPNNPTWFNRD
RFVLSAGHGSMLLYSLLHLSGYDVTMDDLKNFRQWGSKTPGHPEYGHTAGVDATTGPLGQ
GIATAVGMAMAERHLAAKYNRDAYNIVDHYTYAICGDGDLMEGVSAEASSLAAHLQLGRL
VVLYDSNDISLDGDLNRSFSESVEDRYKAYGWQVIRVEDGNDIEAIAKAIEEAKADEKRP
TLIEVRTTIGFGSPNKSGKSASHGSPLGVEETKLTKEAYAWTAEQDFHVAEEVYENFRKT
VQDVGETAQAEWNTMLGEYAQAYPELANELQAAMNGLLPEGWEQNLPTYELGSKAATRNS
SGAVINAIAESVPSFFGGSADLAGSNKTYMNNEKDFTRDDYSGKNIWYGVREFAMGAAMN
GIALHGGLKTYGGTFFVFSDYLRPAIRLAALMQLPVTYVFTHDSIAVGEDGPTHEPIEQL
AALRAMPNVSVIRPADGNESVAAWRLALESTNKPTALVLTRQDLPTLEGAKDDTYEKVAK
GAYVVSASKKETADVILLATGSEVSLAVEAQKALAVDGVDASVVSMPSMDRFEAQTAEYK
ESVLPKAVTKRFAIEMGATFGWHRYVGLEGDVLGIDTFGASAPGEKIMEEYGFTVENVVR
KVKEML
Number of residues
666
Molecular Weight
72408.685
Theoretical pI
4.71
GO Classification
Functions
metal ion binding / transketolase activity
General Function
Transketolase activity
Specific Function
Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017402|Transketolase (tkt2)
ATGTCACATTCAATCGAACAACTTTCTATCAACACGATTCGCACATTATCCATCGATGCG
ATTGAAAAAGCAAACTCTGGTCACCCAGGAATGCCAATGGGTGCAGCACCAATGGCTTAT
ACATTATGGACTCAATTTATGAAACACAATCCAAATAACCCAACGTGGTTTAACCGTGAT
CGTTTCGTATTATCTGCAGGTCATGGTTCAATGTTATTATACAGCCTACTTCACCTATCT
GGTTATGATGTAACAATGGATGACTTAAAGAACTTCCGTCAATGGGGAAGCAAAACTCCA
GGGCATCCTGAGTACGGTCATACAGCTGGTGTAGATGCAACTACTGGTCCACTTGGACAA
GGTATTGCAACTGCTGTAGGTATGGCAATGGCAGAAAGACATTTAGCTGCTAAATATAAC
CGTGATGCGTATAATATAGTAGATCATTATACATACGCTATTTGTGGTGATGGAGATTTA
ATGGAAGGCGTTTCTGCTGAAGCATCTTCATTAGCTGCTCATTTACAATTAGGTCGTCTT
GTTGTGCTTTATGATTCAAACGATATTTCATTAGATGGCGATTTAAATCGTTCATTCTCT
GAAAGTGTAGAAGATCGTTACAAAGCATACGGATGGCAAGTAATCCGTGTTGAGGATGGA
AACGATATTGAAGCTATCGCGAAAGCAATCGAAGAAGCGAAAGCTGACGAAAAACGCCCA
ACGCTAATTGAAGTAAGAACGACAATTGGTTTCGGTTCTCCAAACAAATCAGGAAAATCA
GCTTCACATGGTTCTCCACTTGGTGTAGAAGAAACAAAGTTAACGAAAGAAGCATACGCT
TGGACTGCTGAACAAGACTTCCATGTAGCAGAAGAAGTATATGAAAACTTCCGTAAAACA
GTACAAGATGTTGGTGAAACTGCACAAGCTGAGTGGAATACTATGCTAGGTGAATATGCA
CAAGCATATCCAGAATTAGCAAACGAACTGCAAGCAGCAATGAACGGTCTTCTTCCAGAA
GGTTGGGAGCAAAACTTACCAACTTATGAATTAGGATCAAAAGCAGCAACTCGTAATTCT
TCAGGTGCTGTAATTAATGCAATTGCAGAGTCTGTACCATCATTCTTCGGTGGATCTGCT
GACCTTGCTGGTTCTAACAAAACATACATGAATAACGAAAAAGACTTTACAAGAGATGAT
TACAGCGGTAAAAACATTTGGTACGGTGTACGTGAGTTCGCAATGGGTGCAGCAATGAAC
GGTATTGCACTACATGGTGGTTTAAAAACTTACGGTGGTACGTTCTTCGTATTCTCTGAC
TACTTACGCCCAGCAATTCGTCTTGCAGCATTAATGCAATTGCCGGTAACGTATGTATTC
ACACACGACAGTATCGCTGTTGGTGAAGATGGTCCAACACATGAACCAATCGAGCAATTA
GCAGCGCTACGTGCAATGCCAAATGTATCTGTTATTCGTCCAGCTGACGGTAACGAATCT
GTTGCAGCTTGGAGACTAGCTCTAGAATCTACAAACAAACCAACTGCTTTAGTATTAACT
CGTCAAGATCTTCCAACATTAGAAGGTGCAAAAGACGATACGTATGAAAAAGTAGCAAAA
GGTGCGTATGTAGTTTCTGCAAGCAAGAAAGAAACAGCTGATGTAATCTTACTTGCAACT
GGATCTGAAGTAAGTCTAGCTGTTGAAGCTCAAAAAGCATTAGCAGTAGACGGCGTTGAT
GCATCTGTTGTCAGCATGCCATCTATGGATCGCTTTGAAGCTCAAACAGCTGAGTACAAA
GAATCTGTATTACCAAAAGCAGTAACAAAACGTTTCGCAATCGAAATGGGTGCTACATTC
GGATGGCACCGTTACGTAGGTCTTGAAGGAGATGTGTTAGGTATCGATACATTCGGTGCT
TCTGCTCCTGGTGAGAAGATTATGGAAGAGTATGGATTTACTGTAGAGAACGTTGTTCGT
AAAGTAAAAGAAATGCTTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ81Y15
UniProtKB Entry NameQ81Y15_BACAN
GenBank Protein ID30253517
GenBank Gene IDAE016879
General References
  1. Ravel J, Jiang L, Stanley ST, Wilson MR, Decker RS, Read TD, Worsham P, Keim PS, Salzberg SL, Fraser-Liggett CM, Rasko DA: The complete genome sequence of Bacillus anthracis Ames "Ancestor". J Bacteriol. 2009 Jan;191(1):445-6. doi: 10.1128/JB.01347-08. Epub 2008 Oct 24. [PubMed:18952800]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02078TriglymeexperimentalunknownDetails