Hyaluronan and proteoglycan link protein 4

Details

Name
Hyaluronan and proteoglycan link protein 4
Synonyms
  • Brain link protein 2
  • BRAL2
  • KIAA1926
Gene Name
HAPLN4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008715|Hyaluronan and proteoglycan link protein 4
MVCARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHR
GGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQG
DGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAE
AQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAG
GGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAV
AKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFG
VYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV
Number of residues
402
Molecular Weight
42801.105
Theoretical pI
Not Available
GO Classification
Functions
hyaluronic acid binding
Processes
cell adhesion / central nervous system development / skeletal system development
Components
proteinaceous extracellular matrix
General Function
Hyaluronic acid binding
Specific Function
Binds to hyaluronic acid and may be involved in formation of the extracellular matrix.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017565|Hyaluronan and proteoglycan link protein 4 (HAPLN4)
ATGGTGTGCGCTCGGGCGGCCCTCGGTCCCGGCGCGCTCTGGGCCGCGGCCTGGGGCGTC
CTGCTGCTCACAGCCCCTGCGGGGGCGCAGCGTGGCCGGAAGAAGGTCGTGCACGTGCTG
GAGGGTGAGTCGGGCTCGGTAGTGGTACAGACAGCGCCTGGGCAGGTGGTAAGCCACCGT
GGTGGCACCATCGTCTTGCCCTGCCGCTACCACTATGAGGCAGCCGCCCACGGTCACGAC
GGCGTCCGGCTCAAGTGGACAAAGGTGGTGGACCCGCTGGCCTTCACCGACGTCTTCGTG
GCACTAGGCCCCCAGCACCGGGCATTCGGCAGCTACCGTGGGCGGGCTGAGCTGCAGGGC
GACGGGCCTGGGGATGCCTCCCTGGTCCTCCGCAACGTCACGCTGCAAGACTACGGGCGC
TATGAGTGCGAAGTCACCAATGAGCTGGAAGATGACGCTGGCATGGTCAAGCTGGACCTG
GAAGGCGTGGTCTTTCCCTACCACCCCCGTGGAGGCCGATACAAGCTGACCTTCGCGGAG
GCGCAGCGCGCGTGCGCCGAGCAGGACGGCATCCTGGCATCTGCAGAACAGCTGCACGCG
GCCTGGCGCGACGGCCTGGACTGGTGCAACGCGGGCTGGTTGCGCGACGGCTCAGTGCAA
TACCCCGTGAACCGGCCCCGGGAGCCCTGCGGCGGCCTGGGGGGGACCGGGAGTGCAGGG
GGCGGCGGTGATGCCAACGGGGGCCTGCGCAACTACGGGTATCGCCATAACGCCGAGGAA
CGCTACGACGCCTTCTGCTTCACGTCCAACCTGCCGGGGCGCGTGTTCTTCCTGAAGCCG
CTGCGACCTGTACCCTTCTCCGGAGCTGCGCGCGCGTGTGCTGCGCGTGGCGCGGCCGTG
GCCAAGGTGGGGCAGCTGTTCGCCGCGTGGAAGCTGCAGCTGCTAGACCGCTGCACCGCG
GGTTGGCTGGCCGATGGCAGTGCGCGCTACCCCATCGTGAACCCGCGAGCGCGCTGCGGA
GGCCGCAGGCCTGGTGTGCGCAGCCTCGGCTTCCCGGACGCCACCCGACGGCTCTTCGGC
GTCTACTGCTACCGCGCTCCAGGAGCACCGGACCCGGCACCTGGCGGCTGGGGCTGGGGC
TGGGCGGGCGGCGGCGGCTGGGCAGGGGGCGCGCGCGATCCTGCTGCCTGGACCCCTCTG
CACGTCTAG
Chromosome Location
19
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ86UW8
UniProtKB Entry NameHPLN4_HUMAN
HGNC IDHGNC:31357
General References
  1. Spicer AP, Joo A, Bowling RA Jr: A hyaluronan binding link protein gene family whose members are physically linked adjacent to chondroitin sulfate proteoglycan core protein genes: the missing links. J Biol Chem. 2003 Jun 6;278(23):21083-91. Epub 2003 Mar 27. [PubMed:12663660]
  2. Bekku Y, Su WD, Hirakawa S, Fassler R, Ohtsuka A, Kang JS, Sanders J, Murakami T, Ninomiya Y, Oohashi T: Molecular cloning of Bral2, a novel brain-specific link protein, and immunohistochemical colocalization with brevican in perineuronal nets. Mol Cell Neurosci. 2003 Sep;24(1):148-59. [PubMed:14550776]
  3. Nagase T, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins. DNA Res. 2001 Aug 31;8(4):179-87. [PubMed:11572484]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails