Multidrug and toxin extrusion protein 2

Details

Name
Multidrug and toxin extrusion protein 2
Synonyms
  • Kidney-specific H(+)/organic cation antiporter
  • MATE-2
  • MATE2
  • Solute carrier family 47 member 2
Gene Name
SLC47A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008601|Multidrug and toxin extrusion protein 2
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL
LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL
KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV
LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD
TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL
ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL
TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
RH
Number of residues
602
Molecular Weight
65083.915
Theoretical pI
Not Available
GO Classification
Functions
antiporter activity / drug transmembrane transporter activity
Processes
drug transmembrane transport / transmembrane transport
Components
integral component of membrane / plasma membrane
General Function
Drug transmembrane transporter activity
Specific Function
Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide, metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, and ganciclovir. Responsible for the secretion of cationic drugs across the brush border membranes.
Pfam Domain Function
Transmembrane Regions
34-54 67-87 120-140 154-174 220-240 249-269 290-309 328-348 369-389 403-423 443-463 467-487 579-599
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021398|Multidrug and toxin extrusion protein 2 (SLC47A2)
ATGGACAGCCTCCAGGACACAGTGGCCCTGGACCATGGGGGCTGCTGCCCTGCCCTCAGC
AGGCTGGTTCCCAGAGGCTTTGGGACTGAGATGTGGACTCTCTTTGCCCTTTCTGGACCC
CTGTTCCTGTTCCAGGTGCTGACTTTTATGATCTACATCGTGAGCACTGTGTTCTGCGGG
CACCTGGGCAAGGTGGAGCTGGCATCGGTGACCCTCGCGGTGGCCTTTGTCAATGTCTGC
GGAGTTTCTGTAGGAGTTGGTTTGTCTTCGGCATGTGACACCTTGATGTCTCAGAGCTTC
GGCAGCCCCAACAAGAAGCACGTGGGCGTGATCCTGCAGCGGGGCGCGCTGGTCCTGCTC
CTCTGCTGCCTCCCTTGCTGGGCGCTCTTCCTCAACACCCAGCACATCCTGCTGCTCTTC
CGGCAGGACCCGGACGTGTCCAGGTTGACCCAGGACTATGTAATGATTTTCATTCCAGGA
CTTCCGGTGATTTTTCTTTACAATCTGCTGGCAAAATATTTGCAAAATCAGAAGATCACC
TGGCCCCAAGTCCTCAGTGGTGTGGTGGGCAACTGTGTCAACGGTGTGGCCAACTATGCC
CTGGTTTCTGTGCTGAACCTGGGGGTCAGGGGCTCCGCCTATGCCAACATCATCTCCCAG
TTTGCACAGACCGTCTTCCTCCTTCTCTACATTGTGCTGAAGAAGCTGCACCTGGAGACG
TGGGCAGGTTGGTCCAGCCAGTGCCTGCAGGACTGGGGCCCCTTCTTCTCCCTGGCTGTC
CCCAGCATGCTCATGATCTGTGTTGAGTGGTGGGCCTATGAGATCGGGAGCTTCCTCATG
GGGCTGCTCAGTGTGGTGGATCTCTCTGCCCAGGCTGTCATCTACGAGGTGGCCACTGTG
ACCTACATGATTCCCTTGGGGCTCAGCATCGGGGTCTGTGTCCGAGTGGGGATGGCTCTG
GGGGCTGCGGATACTGTGCAGGCCAAGCGCTCGGCCGTCTCGGGCGTGCTCAGCATAGTT
GGCATTTCCCTGGTCCTGGGCACCCTGATAAGCATCCTGAAAAATCAGCTGGGGCATATT
TTTACCAATGATGAAGATGTCATTGCCCTGGTGAGCCAGGTCTTGCCGGTTTATAGTGTC
TTTCACGTGTTTGAGGCCATCTGTTGTGTCTATGGCGGAGTTCTGAGAGGAACTGGGAAG
CAGGCCTTTGGTGCCGCTGTGAATGCCATCACATATTACATCATCGGCCTACCACTGGGC
ATCCTTCTGACCTTTGTGGTCAGAATGAGAATCATGGGCCTCTGGCTGGGCATGCTGGCC
TGTGTCTTCCTGGCAACTGCTGCCTTTGTTGCTTATACTGCCCGGCTGGACTGGAAGCTT
GCTGCAGAGGAGGCTAAGAAACATTCAGGCCGGCAGCAGCAGCAGAGAGCAGAGAGCACT
GCAACCAGACCTGGGCCTGAGAAAGCAGTCCTATCTTCAGTGGCTACAGGCAGTTCCCCT
GGCATTACCTTGACAACGTATTCAAGGTCTGAGTGCCACGTGGACTTCTTCAGGACTCCA
GAGGAGGCCCACGCCCTTTCAGCTCCTACCAGCAGACTATCAGTGAAACAGCTGGTCATC
CGCCGTGGGGCTGCTCTGGGGGCGGCGTCAGCCACACTGATGGTGGGGCTCACGGTCAGG
ATCCTAGCCACCAGGCACTAG
Chromosome Location
17
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ86VL8
UniProtKB Entry NameS47A2_HUMAN
HGNC IDHGNC:26439
General References
  1. Masuda S, Terada T, Yonezawa A, Tanihara Y, Kishimoto K, Katsura T, Ogawa O, Inui K: Identification and functional characterization of a new human kidney-specific H+/organic cation antiporter, kidney-specific multidrug and toxin extrusion 2. J Am Soc Nephrol. 2006 Aug;17(8):2127-35. Epub 2006 Jun 28. [PubMed:16807400]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Omote H, Hiasa M, Matsumoto T, Otsuka M, Moriyama Y: The MATE proteins as fundamental transporters of metabolic and xenobiotic organic cations. Trends Pharmacol Sci. 2006 Nov;27(11):587-93. Epub 2006 Sep 25. [PubMed:16996621]
  6. Tanihara Y, Masuda S, Sato T, Katsura T, Ogawa O, Inui K: Substrate specificity of MATE1 and MATE2-K, human multidrug and toxin extrusions/H(+)-organic cation antiporters. Biochem Pharmacol. 2007 Jul 15;74(2):359-71. doi: 10.1016/j.bcp.2007.04.010. Epub 2007 Apr 13. [PubMed:17509534]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00787AcyclovirapprovedunknownsubstrateDetails
DB08840N-methylnicotinamideexperimentalunknownsubstrateDetails
DB12483Copanlisibapproved, investigationalunknowninhibitorDetails
DB12001Abemaciclibapproved, investigationalunknowninhibitorDetails
DB12267Brigatinibapproved, investigationalunknowninhibitorDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB11817Baricitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB11901Apalutamideapproved, investigationalunknowninhibitorDetails
DB12615Plazomicinapproved, investigationalunknowninhibitorDetails
DB06608Tafenoquineapproved, investigationalnoinhibitorDetails
DB01137Levofloxacinapproved, investigationalunknowninhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknowninhibitorDetails
DB04574Estrone sulfateapprovedunknownsubstrateDetails
DB01004Ganciclovirapproved, investigationalunknownsubstrateDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateinhibitorDetails
DB00331MetforminapprovedunknownsubstrateDetails
DB01035ProcainamideapprovedunknownsubstrateDetails
DB01030Topotecanapproved, investigationalunknownsubstrateDetails
DB00536GuanidineapprovedunknownDetails
DB00205Pyrimethamineapproved, investigational, vet_approvednoinhibitorDetails
DB11978Glasdegibapproved, investigationalnoinhibitorDetails
DB12377Relebactamapproved, investigationalunknownsubstrateDetails
DB12978Pexidartinibapproved, investigationalunknowninhibitorDetails
DB01203NadololapprovedunknownsubstrateDetails
DB12500Fedratinibapproved, investigationalunknowninhibitorDetails
DB11757Istradefyllineapproved, investigationalunknowninhibitorDetails
DB11732Lasmiditanapproved, investigationalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails