Penicillin-binding protein 2a

Details

Name
Penicillin-binding protein 2a
Synonyms
Not Available
Gene Name
pbp2a
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Amino acid sequence
>lcl|BSEQ0022113|Penicillin-binding protein 2a
MKLDKLFEKFLSLFKKETSELEDSDSTILRRSRSDRKKLAQVGPIRKFWRRYHLTKIILI
LGLSAGLLVGIYLFAVAKSTNVNDLQNALKTRTLIFDREEKEAGALSGQKGTYVELTDIS
KNLQNAVIATEDRSFYKNDGINYGRFFLAIVTAGRSGGGSTITQQLAKNAYLSQDQTVER
KAKEFFLALELSKKYSKEQILTMYLNNAYFGNGVWGVEDASKKYFGVSASEVSLDQAATL
AGMLKGPELYNPLNSVEDSTNRRDTVLQNMVAAGYIDKNQETEAAEVDMTSQLHDKYEGK
ISDYRYPSYFDAVVNEAVSKYNLTEEEIVNNGYRIYTELDQNYQANMQIVYENTSLFPRA
EDGTFAQSGSVALEPKTGGVRGVVGQVADNDKTGFRNFNYATQSKRSPGSTIKPLVVYTP
AVEAGWALNKQLDNHTMQYDSYKVDNYAGIKTSREVPMYQSLAESLNLPAVATVNDLGVD
KAFEAGEKFGLNMEKVDRVLGVALGSGVETNPLQMAQAYAAFANEGLMPEAHFISRIENA
SGQVIASHKNSQKRVIDKSVADKMTSMMLGTFTNGTGISSSPADYVMAGKTGTTEAVFNP
EYTSDQWVIGYTPDVVISHWLGFPTTDENHYLAGSTSNGAAHVFRNIANTILPYTPGSTF
TVENAYKQNGIAPANTKRQVQTNDNSQTDDNLSDIRGRAQSLVDEASRAISDAKIKEKAQ
TIWDSIVNLFR
Number of residues
731
Molecular Weight
80797.94
Theoretical pI
Not Available
GO Classification
Functions
penicillin binding / peptidoglycan glycosyltransferase activity / transferase activity, transferring acyl groups
Components
integral component of membrane
General Function
Transferase activity, transferring acyl groups
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
57-77
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022114|Penicillin-binding protein 2a (pbp2a)
ATGAAATTAGATAAATTATTTGAGAAATTTCTTTCTCTTTTTAAAAAAGAAACAAGTGAA
CTAGAGGACTCTGATTCTACTATCTTACGTCGCTCTCGTAGTGATCGAAAAAAATTAGCC
CAAGTAGGTCCGATTCGAAAATTCTGGCGTCGTTATCATCTAACAAAGATTATCCTTATA
CTAGGTTTGAGTGCAGGCTTGCTAGTTGGAATCTATTTGTTTGCTGTAGCCAAGTCGACC
AATGTCAATGATTTGCAAAATGCCTTGAAAACTCGGACTCTTATTTTTGACCGTGAAGAA
AAAGAGGCTGGTGCCTTGTCTGGTCAAAAGGGAACCTATGTTGAGCTGACTGACATCAGT
AAAAACTTGCAGAATGCTGTTATTGCGACAGAAGACCGTTCTTTCTATAAAAATGACGGG
ATTAACTATGGCCGTTTCTTCTTGGCTATTGTCACTGCTGGACGTTCAGGTGGTGGCTCT
ACCATTACCCAACAGCTGGCTAAAAACGCCTATTTATCGCAGGATCAAACTGTTGAGAGA
AAAGCGAAAGAATTTTTCCTTGCCTTAGAATTAAGCAAAAAATATAGTAAGGAGCAAATT
CTAACCATGTACCTTAACAACGCTTATTTTGGAAATGGTGTGTGGGGTGTAGAAGATGCG
AGTAAGAAATACTTTGGAGTTTCTGCATCAGAAGTGAGTCTGGATCAAGCTGCGACTCTG
GCAGGGATGCTCAAGGGGCCGGAACTGTATAATCCCTTGAATTCCGTAGAAGATTCTACT
AATCGGCGCGATACTGTCTTGCAGAATATGGTTGCAGCAGGATATATTGATAAAAACCAA
GAAACCGAAGCTGCTGAAGTTGATATGACTTCGCAATTGCACGATAAGTATGAAGGAAAA
ATCTCAGATTACCGTTACCCCTCTTATTTTGATGCGGTGGTTAATGAAGCTGTTTCCAAG
TATAATCTAACAGAGGAAGAGATTGTCAATAATGGCTACCGCATTTACACAGAGCTGGAC
CAAAACTACCAAGCAAATATGCAGATTGTTTATGAAAACACATCGCTATTTCCGAGGGCA
GAGGATGGAACGTTTGCTCAATCAGGAAGTGTAGCTCTCGAACCGAAAACAGGGGGAGTT
CGTGGAGTTGTCGGTCAAGTTGCTGACAATGATAAAACTGGATTCCGGAATTTCAACTAT
GCAACCCAATCAAAGCGTAGTCCTGGTTCTACAATTAAGCCTTTAGTTGTTTATACACCA
GCAGTTGAAGCAGGCTGGGCTTTGAATAAGCAGTTGGATAACCATACCATGCAGTATGAT
AGCTATAAGGTTGATAACTATGCAGGGATCAAAACAAGTCGAGAAGTTCCTATGTATCAA
TCCTTGGCAGAATCGCTTAATCTACCTGCTGTTGCCACTGTTAATGATTTGGGTGTTGAC
AAGGCTTTTGAGGCAGGCGAAAAATTCGGACTCAACATGGAAAAGGTCGACCGTGTTCTT
GGTGTCGCCTTGGGAAGCGGTGTTGAAACCAACCCTCTTCAAATGGCTCAAGCATACGCT
GCCTTTGCAAATGAAGGTTTAATGCCTGAAGCTCATTTTATTAGTAGAATTGAAAATGCT
AGTGGACAAGTTATTGCGAGTCATAAAAATTCACAAAAACGGGTGATTGATAAGTCTGTA
GCTGACAAGATGACCAGTATGATGTTGGGGACTTTCACCAACGGTACCGGTATTAGTTCA
TCGCCTGCAGACTATGTCATGGCAGGGAAAACTGGAACAACTGAAGCAGTTTTCAATCCG
GAGTACACAAGTGACCAGTGGGTAATTGGTTATACTCCGGATGTAGTGATTAGCCACTGG
CTTGGCTTTCCGACCACTGATGAAAATCACTATCTAGCTGGCTCTACTTCAAACGGTGCA
GCTCATGTCTTTAGAAACATTGCCAATACTATTTTACCTTATACGCCAGGAAGTACCTTT
ACGGTTGAAAATGCTTATAAGCAAAATGGAATTGCACCAGCCAATACAAAAAGACAAGTA
CAAACCAATGATAATAGCCAGACAGATGATAATTTGTCTGATATTCGAGGGCGTGCGCAA
AGTCTAGTAGATGAGGCTAGCCGGGCTATCTCAGATGCGAAGATTAAGGAAAAGGCTCAA
ACAATATGGGATTCGATAGTCAATCTATTTCGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8DNB6
UniProtKB Entry NameQ8DNB6_STRR6
General References
  1. Hoskins J, Alborn WE Jr, Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ, Fuller W, Geringer C, Gilmour R, Glass JS, Khoja H, Kraft AR, Lagace RE, LeBlanc DJ, Lee LN, Lefkowitz EJ, Lu J, Matsushima P, McAhren SM, McHenney M, McLeaster K, Mundy CW, Nicas TI, Norris FH, O'Gara M, Peery RB, Robertson GT, Rockey P, Sun PM, Winkler ME, Yang Y, Young-Bellido M, Zhao G, Zook CA, Baltz RH, Jaskunas SR, Rosteck PR Jr, Skatrud PL, Glass JI: Genome of the bacterium Streptococcus pneumoniae strain R6. J Bacteriol. 2001 Oct;183(19):5709-17. [PubMed:11544234]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00493CefotaximeapprovedyesinhibitorDetails
DB00319PiperacillinapprovedyesinhibitorDetails
DB00607Nafcillinapproved, investigationalyesinhibitorDetails
DB00415Ampicillinapproved, vet_approvedyesinhibitorDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB01163Amdinocillininvestigational, withdrawnyesinhibitorDetails
DB01603Meticillinapproved, investigationalyesinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedyesinhibitorDetails
DB00713Oxacillinapproved, investigationalyesinhibitorDetails
DB01331CefoxitinapprovedyesinhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedyesinhibitorDetails
DB03313Cephalosporin CexperimentalyesinhibitorDetails
DB08795AzidocillinexperimentalyesinhibitorDetails
DB01147Cloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB00739Hetacillinapproved, vet_approved, withdrawnyesinhibitorDetails