Purine nucleotide phosphorylase, putative

Details

Name
Purine nucleotide phosphorylase, putative
Synonyms
  • EC 2.4.2.3
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0022444|Purine nucleotide phosphorylase, putative
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
Number of residues
245
Molecular Weight
26857.88
Theoretical pI
6.49
GO Classification
Functions
uridine phosphorylase activity
Processes
nucleoside metabolic process
General Function
Uridine phosphorylase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022445|Purine nucleotide phosphorylase, putative
ATGGATAATCTTTTACGCCATTTAAAAATAAGCAAGGAACAAATAACACCAGTTGTTTTA
GTTGTAGGAGATCCAGGAAGAGTCGACAAGATAAAAGTGGTATGTGATTCATATGTTGAT
TTAGCATACAACAGAGAATACAAAAGTGTAGAATGTCATTATAAGGGTCAGAAATTTTTA
TGTGTTAGTCACGGTGTAGGTTCAGCAGGATGTGCTGTATGTTTTGAAGAATTATGTCAA
AATGGAGCTAAAGTAATTATTCGTGCAGGTTCATGTGGATCTCTTCAACCAGATTTAATA
AAAAGAGGTGACATATGTATATGTAATGCAGCTGTTAGGGAAGATAGAGTATCTCATTTA
TTAATTCATGGAGATTTCCCAGCTGTTGGTGATTTTGATGTTTATGATACTTTAAATAAA
TGTGCACAAGAATTGAATGTGCCAGTTTTTAATGGTATCAGTGTTTCATCAGATATGTAT
TATCCCAATAAAATTATTCCTTCAAGATTAGAAGATTATTCTAAAGCTAATGCTGCTGTT
GTTGAAATGGAACTAGCCACTCTTATGGTTATTGGAACCTTAAGAAAAGTTAAAACAGGT
GGTATTCTTATTGTTGATGGATGTCCATTCAAATGGGACGAAGGGGATTTCGACAACAAT
TTAGTTCCTCACCAATTAGAAAATATGATTAAAATAGCCTTAGGAGCATGTGCAAAATTA
GCAACCAAATATGCCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8I3X4
UniProtKB Entry NameQ8I3X4_PLAF7
GenBank Gene IDAL929352
General References
  1. Shi W, Ting LM, Kicska GA, Lewandowicz A, Tyler PC, Evans GB, Furneaux RH, Kim K, Almo SC, Schramm VL: Plasmodium falciparum purine nucleoside phosphorylase: crystal structures, immucillin inhibitors, and dual catalytic function. J Biol Chem. 2004 Apr 30;279(18):18103-6. Epub 2004 Feb 23. [PubMed:14982926]
  2. Schnick C, Robien MA, Brzozowski AM, Dodson EJ, Murshudov GN, Anderson L, Luft JR, Mehlin C, Hol WG, Brannigan JA, Wilkinson AJ: Structures of Plasmodium falciparum purine nucleoside phosphorylase complexed with sulfate and its natural substrate inosine. Acta Crystallogr D Biol Crystallogr. 2005 Sep;61(Pt 9):1245-54. Epub 2005 Aug 16. [PubMed:16131758]
  3. Chaikuad A, Brady RL: Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases. BMC Struct Biol. 2009 Jul 3;9:42. doi: 10.1186/1472-6807-9-42. [PubMed:19575810]
  4. Donaldson TM, Ting LM, Zhan C, Shi W, Zheng R, Almo SC, Kim K: Structural determinants of the 5'-methylthioinosine specificity of Plasmodium purine nucleoside phosphorylase. PLoS One. 2014 Jan 8;9(1):e84384. doi: 10.1371/journal.pone.0084384. eCollection 2014. [PubMed:24416224]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03881(2S,3R,4S,5S)-3,4-Dihydroxy-2-[(methylsulfanyl)methyl]-5-(4-oxo-4,5-dihydro-1H-pyrrolo[3,2-d]pyrimidin-7-yl)pyrrolidiniumexperimentalunknownDetails
DB11638Artenimolexperimental, investigationalunknownligandDetails