Eukaryotic translation initiation factor 3 subunit C

Details

Name
Eukaryotic translation initiation factor 3 subunit C
Synonyms
  • eIF3c
  • Eukaryotic translation initiation factor 3 subunit 8
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0051486|Eukaryotic translation initiation factor 3 subunit C
MQSKFWAKAIDEDSGDNVTESSESEVEEKKPIVSAQAERWAAIDSSSSEEEERVIKTYEG
KRLHFYETTGNSLNENMYNNDFNLLLKDYENLYKFMIKESADCIPNFAIIYLDKLSKYVE
KTFQNNVEKKNLSKNKAQTLNKLRAKIRKCSEFYQEKLNLYNENPDDFKDDRKKDMDDDE
DDEDNEEDDEEEEEDEEEQEDQDDDNEDEKDQDDDEDGKGKKKLSSKTKSKKGKEKKEEK
EDYDDDNDEEKEDEADDDNDDDDDDSDDWSYSEDDNYASDEEDDKTKNAMSKWGLKTSTK
VEKKKTVKQKKVKKESTKKEEKANRVVEDSQSAKNKGYAELLSTKNLTEDVIRERVKLVI
EKRGRKGLDKHEHINILSKLCEIAKTISTQSYIEVLEHLINLEFDVVSSVYTYMSFNIWN
KVFKYVELILDILIQNENFYLVSINIAEEITEETTNEKEKIIKSCKTLISFLAKLDDELL
KALLYIDVQTEEYRKRLGKTIHMIGLLKKGYNYVKCLKNMPDLAIHISSRILEHMYYKPE
MLFKQIWTYLMNGKEMLSDSLNNSNNIASKEDGQGKKKKRIDNDLFDEKLINNDSINPPK
IIEEYVYEIFEFGTKQQKVKALLQLSYNKSLYDEYLEAKELLNVANVHELAMNSDIQTQI
LYNRNLIQLGLCAFRHGKIYEAHCCLMEICSQNKHKELIAQGISNLKNQEKTLEQERAEK
RRLLSYHMHISIELIECVNNICAMLLEVPNLAKNTYESKKDIISRQFRRFLDIYDKQIFN
NPPENNKEIIILATKHLQKGNWKLCCEKIFSLSIWPKFPDKEKVQNILKEKIKQEAMRTY
IFRYISIYESFSIDQLCVMFDLNQNVVHSILSKMMINQEIPAFWNESSKFILISKVNPTT
LQNLALKLAENVNEVMEQNELALNMKNPKFMFMQERRTQMKEEKSNWTQKKGDQKYQKNY
NQKKNAHYKKNYKDNNANKNYKKN
Number of residues
984
Molecular Weight
116012.945
Theoretical pI
Not Available
GO Classification
Functions
translation initiation factor activity / translation initiation factor binding
Processes
formation of translation preinitiation complex / regulation of translational initiation / translational initiation
Components
eukaryotic 43S preinitiation complex / eukaryotic 48S preinitiation complex / eukaryotic translation initiation factor 3 complex
General Function
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
Specific Function
Translation initiation factor activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0051487|Eukaryotic translation initiation factor 3 subunit C
ATGCAATCGAAATTTTGGGCCAAGGCAATTGATGAAGATAGTGGGGATAATGTAACAGAA
TCTTCAGAGAGTGAAGTTGAGGAAAAGAAGCCCATTGTCTCTGCACAGGCAGAAAGGTGG
GCCGCCATAGATAGCAGCAGCTCAGAAGAAGAAGAAAGAGTTATTAAAACATATGAAGGG
AAAAGGCTACATTTTTATGAGACTACAGGAAATAGTTTAAATGAGAATATGTATAATAAT
GATTTTAATCTTCTTTTAAAAGATTATGAAAATTTATATAAATTTATGATAAAAGAAAGC
GCTGATTGTATCCCTAATTTTGCTATAATATACTTAGATAAATTATCTAAATATGTTGAA
AAAACATTCCAGAATAATGTCGAAAAAAAAAATTTGAGCAAAAATAAAGCACAAACCTTA
AATAAATTGAGAGCCAAAATTAGAAAATGTAGTGAATTTTATCAAGAAAAATTAAACTTA
TATAATGAAAATCCTGACGACTTTAAAGATGACAGAAAAAAAGATATGGATGATGATGAA
GATGATGAAGACAATGAAGAAGACGATGAAGAAGAGGAGGAAGACGAAGAAGAACAAGAA
GATCAAGATGATGATAATGAAGATGAAAAGGATCAAGATGATGATGAAGATGGAAAAGGG
AAAAAGAAATTAAGTAGTAAAACAAAATCAAAAAAAGGTAAAGAAAAGAAAGAAGAAAAA
GAAGATTATGACGATGATAATGATGAAGAAAAAGAAGATGAAGCAGATGATGATAATGAT
GATGATGATGATGATAGTGATGATTGGTCTTATAGTGAAGATGATAACTATGCTTCTGAT
GAAGAAGATGATAAAACAAAAAATGCTATGAGTAAATGGGGTTTAAAAACTAGCACAAAA
GTGGAAAAGAAGAAAACAGTTAAACAGAAAAAAGTAAAAAAAGAATCTACCAAAAAAGAA
GAAAAAGCTAATCGTGTTGTGGAAGATTCACAATCAGCTAAAAATAAAGGATATGCAGAA
TTATTAAGTACGAAGAATTTAACTGAAGATGTTATAAGGGAAAGAGTTAAATTAGTTATA
GAGAAAAGAGGTAGAAAGGGATTAGATAAACATGAACATATTAATATATTATCTAAATTA
TGTGAAATAGCAAAAACAATTAGTACACAATCTTATATAGAAGTTTTAGAACACTTAATT
AATTTAGAATTTGATGTAGTATCCAGTGTATATACCTATATGTCTTTTAATATATGGAAT
AAAGTATTTAAATATGTAGAACTTATTTTAGATATATTAATTCAAAATGAAAACTTTTAT
TTAGTATCAATAAACATAGCAGAAGAAATAACAGAAGAAACAACTAATGAAAAAGAAAAA
ATTATAAAATCTTGTAAAACACTTATATCATTTTTAGCCAAATTAGATGATGAATTATTG
AAAGCTTTATTATATATAGATGTTCAAACAGAAGAATATCGAAAAAGATTAGGTAAAACA
ATACATATGATAGGTTTATTAAAAAAAGGATATAATTATGTTAAATGTTTAAAAAATATG
CCTGATTTAGCTATTCACATATCCTCTAGAATTTTAGAGCATATGTATTATAAACCTGAA
ATGTTATTTAAACAAATATGGACTTACCTTATGAACGGAAAAGAAATGTTATCAGATTCA
TTAAATAATTCAAATAATATTGCATCAAAGGAAGATGGACAAGGCAAGAAAAAAAAAAGA
ATTGATAATGATTTATTTGATGAAAAATTAATTAATAATGATAGTATTAATCCACCTAAA
ATTATTGAAGAATATGTATATGAAATATTTGAATTTGGAACAAAGCAACAAAAGGTAAAA
GCATTATTACAATTATCTTATAATAAAAGTTTATATGATGAATATTTGGAAGCCAAAGAA
TTATTAAATGTAGCTAATGTACATGAATTAGCTATGAATTCAGATATACAAACGCAAATA
TTATATAATCGTAATTTAATACAATTAGGTTTATGTGCATTTAGACACGGGAAAATATAT
GAAGCTCATTGTTGCTTAATGGAAATTTGTTCACAAAATAAACATAAGGAATTAATAGCT
CAAGGTATATCAAATTTAAAAAATCAAGAAAAAACCCTAGAACAAGAAAGAGCAGAAAAA
AGACGATTATTATCATATCACATGCATATATCTATAGAATTAATAGAATGTGTAAATAAT
ATATGTGCCATGTTATTAGAAGTACCAAATTTAGCAAAAAATACATATGAATCAAAAAAA
GATATTATATCACGACAATTTAGAAGATTTCTAGATATATATGATAAACAAATATTTAAC
AACCCTCCTGAAAATAATAAAGAAATTATTATATTAGCAACAAAACATTTACAAAAGGGT
AATTGGAAATTATGTTGTGAAAAAATATTTAGTTTATCAATCTGGCCAAAATTCCCAGAT
AAAGAAAAAGTACAAAATATACTTAAGGAAAAAATTAAACAAGAAGCTATGAGAACATAT
ATATTCAGATATATATCAATATATGAATCATTCTCTATTGATCAATTATGTGTTATGTTT
GATTTAAATCAAAATGTTGTACATTCCATATTAAGTAAAATGATGATTAATCAAGAAATA
CCAGCTTTCTGGAATGAAAGTAGTAAATTTATACTTATTAGTAAAGTTAATCCAACGACC
TTACAAAATTTGGCTCTTAAGTTAGCTGAAAATGTAAATGAAGTAATGGAGCAAAACGAA
TTGGCCTTAAACATGAAAAACCCAAAATTTATGTTCATGCAAGAGAGAAGAACACAAATG
AAAGAAGAGAAATCAAACTGGACACAGAAGAAAGGAGATCAAAAATATCAAAAAAATTAT
AACCAAAAGAAAAATGCACATTATAAAAAAAATTACAAAGATAATAATGCAAATAAAAAT
TACAAAAAAAATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8I5Y3
UniProtKB Entry NameQ8I5Y3_PLAF7
General References
  1. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [PubMed:12368864]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11638Artenimolexperimental, investigationalunknownligandDetails