40S ribosomal protein S21
Details
- Name
- 40S ribosomal protein S21
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Plasmodium falciparum (isolate 3D7)
- Amino acid sequence
>lcl|BSEQ0051482|40S ribosomal protein S21 MFNDQKVLVDIYIPRKCSATSRLIPAKEHGAVQINVGMVDANGVYNGKTETFAISGHVRQ NGESDACLNRLMYEKKLLSFQN
- Number of residues
- 82
- Molecular Weight
- 9145.425
- Theoretical pI
- Not Available
- GO Classification
- Functionsstructural constituent of ribosomeProcessesendonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / translationComponentscytosolic small ribosomal subunit
- General Function
- Not Available
- Specific Function
- Structural constituent of ribosome
- Pfam Domain Function
- Ribosomal_S21e (PF01249)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051483|40S ribosomal protein S21 ATGTTTAACGATCAAAAAGTTTTAGTCGATATTTATATACCCAGGAAGTGCTCAGCTACA TCACGACTTATTCCGGCCAAGGAACATGGAGCTGTACAAATAAATGTTGGAATGGTTGAT GCTAATGGAGTTTACAACGGTAAAACCGAAACCTTCGCTATCTCTGGTCATGTCAGACAA AATGGAGAATCAGATGCTTGCTTAAATAGACTTATGTATGAAAAGAAATTATTATCCTTT CAAAACTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q8IHS5 UniProtKB Entry Name Q8IHS5_PLAF7 - General References
- Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [Article]
- Wong W, Bai XC, Brown A, Fernandez IS, Hanssen E, Condron M, Tan YH, Baum J, Scheres SH: Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine. Elife. 2014 Jun 9;3. doi: 10.7554/eLife.03080. [Article]
- Sun M, Li W, Blomqvist K, Das S, Hashem Y, Dvorin JD, Frank J: Dynamical features of the Plasmodium falciparum ribosome during translation. Nucleic Acids Res. 2015 Dec 2;43(21):10515-24. doi: 10.1093/nar/gkv991. Epub 2015 Oct 1. [Article]