Thioredoxin-like protein

Details

Name
Thioredoxin-like protein
Synonyms
  • Thioredoxin-like protein 1
Gene Name
tlp1
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0051534|Thioredoxin-like protein
MKRTDDKIYVDINNEEEYKNLFDDKNDILYIIDIYTRWCGPCIFTFEMINKIYKNNLIFS
ENVKLFSICAQTVSSLKNYDNNCKPFYIILKNGEIIQQIQGCNIPLIFSFIDEHLMNKKI
N
Number of residues
121
Molecular Weight
14423.54
Theoretical pI
Not Available
GO Classification
Functions
nucleoside diphosphate kinase activity
Processes
cell redox homeostasis
Components
cytosol
General Function
Not Available
Specific Function
Nucleoside diphosphate kinase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051535|Thioredoxin-like protein (tlp1)
ATGAAACGAACTGACGATAAAATTTACGTGGATATAAATAACGAAGAAGAATATAAAAAC
TTATTTGATGATAAGAATGATATTCTTTATATAATAGATATTTATACTAGATGGTGTGGG
CCATGTATTTTTACTTTTGAAATGATAAATAAAATTTATAAAAACAATTTAATCTTTTCA
GAGAATGTCAAGTTATTTTCTATATGTGCACAAACTGTGTCTTCATTAAAAAATTATGAT
AATAATTGTAAACCCTTTTATATCATATTGAAAAATGGAGAAATAATACAACAAATTCAA
GGATGTAATATACCACTTATTTTTTCATTTATTGATGAGCATTTGATGAATAAGAAAATA
AATTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8IKL4
UniProtKB Entry NameQ8IKL4_PLAF7
General References
  1. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [PubMed:12368864]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11638Artenimolexperimental, investigationalunknownligandDetails