Voltage-dependent calcium channel subunit alpha-2/delta-3

Details

Name
Voltage-dependent calcium channel subunit alpha-2/delta-3
Synonyms
  • Voltage-gated calcium channel subunit alpha-2/delta-3
Gene Name
CACNA2D3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006864|Voltage-dependent calcium channel subunit alpha-2/delta-3
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
LLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL
HPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD
KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS
FVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS
LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITL
YDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQ
KLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCE
SVAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLQAQTVLL
LLPLLLMLFSR
Number of residues
1091
Molecular Weight
123010.22
Theoretical pI
5.54
GO Classification
Functions
calcium channel activity / calcium channel regulator activity / metal ion binding / voltage-gated ion channel activity
Processes
calcium ion transmembrane transport / regulation of calcium ion transport
Components
voltage-gated calcium channel complex
General Function
Voltage-gated ion channel activity
Specific Function
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G) (By similarity).
Pfam Domain Function
Transmembrane Regions
1069-1089
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012478|Voltage-dependent calcium channel subunit alpha-2/delta-3 (CACNA2D3)
ATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCCTCGGCGCTTCTCGCTGCC
GCGCTTCTCTACGCCGCGCTGGGGGACGTGGTGCGCTCGGAGCAGCAGATACCGCTCTCC
GTGGTGAAGCTCTGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTAC
TCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAA
GAAATCGATGGCCTCCAACTGGTAAAGAAGCTGGCAAAGAACATGGAAGAGATGTTTCAC
AAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACAT
GAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGAC
AAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTT
AATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAAC
AAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTA
GATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTT
TTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGAC
TGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTA
GTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCA
TCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAG
CTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAA
GAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATA
GCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATC
TGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTT
GCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAG
GCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAG
ATCTCCACCTTGGCTGATGTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGG
CCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACT
CTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCC
ATGCCTGTGTTTAGTAAGCAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTT
GGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATT
CACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGG
CTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCT
GAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACG
GGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATG
ACAAATGACTACTATTATACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTT
TCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCAT
GACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTA
CACCCTGAGCACCGCCATCTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAA
GAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTG
AGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGAC
AAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTT
GTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATT
TTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGC
TTCGTCTACTCGATCCCATTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCA
AGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATT
CAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCC
CTGGATGGCAAATGCTCCATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGAC
AATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAG
ATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTT
TATGACTACCAAGCCATGTGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTC
CTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTG
TTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAG
AAATTGAAACAGACCCTGGAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGC
ACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATC
CAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAA
TCTGTGGCCCCCATCACCATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGT
GAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCT
GAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTT
CTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGGTGA
Chromosome Location
3
Locus
3p21.1
External Identifiers
ResourceLink
UniProtKB IDQ8IZS8
UniProtKB Entry NameCA2D3_HUMAN
GenBank Protein ID7105926
GenBank Gene IDAJ272268
HGNC IDHGNC:15460
General References
  1. Hanke S, Bugert P, Chudek J, Kovacs G: Cloning a calcium channel alpha2delta-3 subunit gene from a putative tumor suppressor gene region at chromosome 3p21.1 in conventional renal cell carcinoma. Gene. 2001 Feb 7;264(1):69-75. [PubMed:11245980]
  2. Qin N, Yagel S, Momplaisir ML, Codd EE, D'Andrea MR: Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit. Mol Pharmacol. 2002 Sep;62(3):485-96. [PubMed:12181424]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Gong HC, Hang J, Kohler W, Li L, Su TZ: Tissue-specific expression and gabapentin-binding properties of calcium channel alpha2delta subunit subtypes. J Membr Biol. 2001 Nov 1;184(1):35-43. [PubMed:11687876]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB06712Nilvadipineapproved, investigationalunknowninhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB00381AmlodipineapprovedyesblockerDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails