Matrix metalloproteinase-21

Details

Name
Matrix metalloproteinase-21
Synonyms
  • 3.4.24.-
  • MMP-21
Gene Name
MMP21
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012573|Matrix metalloproteinase-21
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRY
GWSGVWAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVP
DMRPPPPSAPPSPPGPPPRARSRRSPRAPLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRL
LGEALSSQLSVADQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFGRGRHLGCPR
AFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKVAVHEIGHVLGLPHTYRTGSI
MQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFR
NSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYD
SDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNR
VLNSYPKRITEVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSW
LPANGLFPKKFISEKWFDVCDVHISTLNM
Number of residues
569
Molecular Weight
65042.83
Theoretical pI
9.42
GO Classification
Functions
calcium ion binding / metalloendopeptidase activity / zinc ion binding
Processes
hematopoietic progenitor cell differentiation
Components
extracellular matrix / extracellular region
General Function
Zinc ion binding
Specific Function
May have an important and specific function in tumor progression and embryogenesis. Cleaves alpha-1-antitrypsin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012574|Matrix metalloproteinase-21 (MMP21)
ATGCTCGCCGCCTCCATCTTCCGTCCGACACTGCTGCTCTGCTGGCTGGCTGCTCCCTGG
CCCACCCAGCCCGAGAGTCTCTTCCACAGCCGGGACCGCTCGGACCTGGAGCCGTCCCCA
CTGCGCCAGGCCAAGCCCATTGCCGACCTCCACGCTGCTCAGCGGTTCCTGTCCAGATAC
GGCTGGTCAGGGGTGTGGGCGGCCTGGGGGCCCAGTCCCGAGGGGCCGCCGGAGACCCCC
AAGGGCGCCGCCCTGGCCGAGGCGGTGCGCAGGTTCCAGCGGGCGAACGCGCTGCCGGCC
AGCGGGGAGCTGGACGCGGCCACCCTAGCGGCCATGAACCGGCCGCGCTGCGGGGTCCCG
GACATGCGCCCACCGCCCCCCTCCGCCCCGCCTTCGCCCCCGGGCCCGCCCCCCAGAGCC
CGCTCCAGGCGCTCCCCGCGGGCGCCGCTGTCCTTGTCCCGGCGGGGTTGGCAGCCCCGG
GGCTACCCCGACGGCGGAGCTGCCCAGGCCTTCTCCAAGAGGACGCTGAGCTGGCGGCTG
CTGGGCGAGGCCCTGAGCAGCCAACTGTCCGTGGCCGACCAGCGGCGCATTGTGGCGCTG
GCCTTCAGGATGTGGAGCGAGGTGACGCCGCTGGACTTCCGCGAGGACCTGGCCGCCCCC
GGGGCCGCGGTCGACATCAAGCTGGGCTTTGGGAGAGGCCGGCACCTGGGCTGTCCGCGG
GCCTTCGATGGGAGCGGGCAGGAGTTTGCACACGCCTGGCGCCTAGGTGACATTCACTTT
GACGACGACGAGCACTTCACACCTCCCACCAGTGACACGGGCATCAGCCTTCTCAAGGTG
GCCGTCCATGAAATTGGCCATGTCCTGGGCTTGCCTCACACCTACAGGACGGGATCCATA
ATGCAACCAAATTACATTCCCCAGGAGCCTGCCTTTGAGTTGGACTGGTCAGACAGGAAA
GCAATTCAAAAGCTGTATGGCTCCTGTGAGGGATCATTTGATACTGCGTTTGACTGGATT
CGCAAAGAGAGAAACCAATATGGAGAGGTGATGGTGAGATTTAGCACATATTTCTTCCGT
AACAGCTGGTACTGGCTTTATGAAAATCGAAACAATAGGACACGCTATGGGGACCCTATC
CAAATCCTCACTGGCTGGCCTGGAATCCCAACACACAACATAGATGCCTTTGTTCACATC
TGGACATGGAAAAGAGATGAACGTTATTTTTTTCAAGGAAATCAATACTGGAGATATGAC
AGTGACAAGGATCAGGCCCTCACAGAAGATGAACAAGGAAAAAGCTATCCCAAATTGATT
TCAGAAGGATTTCCTGGCATCCCAAGTCCCCTAGACACGGCGTTTTATGACCGAAGACAG
AAGTTAATTTACTTCTTCAAGGAGTCCCTTGTATTTGCATTTGATGTCAACAGAAATCGA
GTACTTAATTCTTATCCAAAGAGGATTACTGAAGTTTTTCCAGCAGTAATACCACAAAAT
CATCCTTTCAGAAATATAGATTCCGCTTATTACTCCTATGCATACAACTCCATTTTCTTT
TTCAAAGGCAATGCATACTGGAAGGTAGTTAATGACAAGGACAAACAACAGAATTCCTGG
CTTCCTGCTAATGGCTTATTTCCAAAAAAGTTTATTTCAGAGAAGTGGTTTGATGTTTGT
GACGTCCATATCTCCACACTGAACATGTAA
Chromosome Location
10
Locus
10q26.13
External Identifiers
ResourceLink
UniProtKB IDQ8N119
UniProtKB Entry NameMMP21_HUMAN
GenBank Protein ID22134532
GenBank Gene IDAF331526
HGNC IDHGNC:14357
General References
  1. Ahokas K, Lohi J, Lohi H, Elomaa O, Karjalainen-Lindsberg ML, Kere J, Saarialho-Kere U: Matrix metalloproteinase-21, the human orthologue for XMMP, is expressed during fetal development and in cancer. Gene. 2002 Nov 13;301(1-2):31-41. [PubMed:12490321]
  2. Marchenko GN, Marchenko ND, Strongin AY: The structure and regulation of the human and mouse matrix metalloproteinase-21 gene and protein. Biochem J. 2003 Jun 1;372(Pt 2):503-15. [PubMed:12617721]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00786MarimastatinvestigationalyesinhibitorDetails