DNA-directed RNA polymerase subunit beta

Details

Name
DNA-directed RNA polymerase subunit beta
Synonyms
  • 2.7.7.6
  • RNA polymerase subunit beta
  • RNAP subunit beta
  • Transcriptase subunit beta
Gene Name
rpoB
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0019408|DNA-directed RNA polymerase subunit beta
MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKG
KGGLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPL
MTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNG
VVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKD
EVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERML
MGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTR
ERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVF
SVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEED
GEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPA
SENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGE
KARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLA
NRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQR
YISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQP
LGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPS
VPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
Number of residues
1119
Molecular Weight
125263.41
Theoretical pI
5.73
GO Classification
Functions
DNA binding / DNA-directed RNA polymerase activity / ribonucleoside binding
Processes
transcription, DNA-templated
General Function
Ribonucleoside binding
Specific Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0019409|DNA-directed RNA polymerase subunit beta (rpoB)
ATGGAGATCAAGCGGTTCGGTCGCATCCGAGAGGTTATCCCCCTTCCACCCCTCACCGAG
ATCCAGGTGGAGTCCTACCGCAGGGCCCTGCAGGCCGACGTCCCCCCGGAGAAGCGGGAG
AACGTCGGCATCCAGGCGGCCTTCCGGGAGACCTTCCCCATTGAGGAGGAGGACAAGGGC
AAGGGCGGTTTGGTGCTGGACTTCCTGGAGTACCGCCTGGGCGAGCCCCCCTTCCCCCAG
GACGAGTGCCGGGAGAAGGACCTCACCTACCAGGCCCCCCTCTACGCCCGGCTCCAGCTC
ATCCACAAGGACACGGGCCTCATCAAGGAGGACGAGGTCTTCCTGGGGCACATCCCCCTG
ATGACCGAGGACGGCTCCTTCATCATCAACGGGGCCGACCGGGTCATCGTCTCCCAGATC
CACCGCTCCCCCGGGGTCTACTTCACCCCCGACCCCGCCCGGCCCGGGCGCTACATCGCC
AGCATCATCCCCCTGCCCAAGCGGGGCCCCTGGATTGACCTGGAGGTGGAGCCGAACGGC
GTCGTCTCCATGAAGGTCAACAAGCGGAAGTTCCCCCTGGTCCTCCTCCTTCGGGTCCTG
GGGTACGACCAGGAGACCCTGGCCCGGGAGCTTGGGGCCTACGGGGAGCTGGTCCAGGGC
CTCATGGACGAGAGCGTCTTCGCCATGCGCCCCGAGGAGGCTCTGATCCGCCTCTTCACC
CTCCTCCGCCCCGGGGACCCGCCCAAGCGGGACAAGGCCGTGGCCTACGTCTACGGCCTC
ATCGCCGACCCCAGGCGGTACGACCTGGGCGAGGCCGGGCGGTACAAGGCGGAGGAGAAG
CTGGGGATCCGCCTCTCGGGCCGCACCCTGGCCCGCTTTGAGGACGGGGAGTTCAAGGAC
GAGGTCTTCCTCCCCACCCTCCGCTACCTCTTCGCCCTCACCGCCGGGGTCCCGGGCCAC
GAGGTGGACGACATTGACCACCTGGGCAACCGCCGCATCCGCACCGTGGGGGAGCTCATG
ACCGACCAGTTCCGGGTGGGGCTCGCCCGCCTCGCCCGGGGGGTGCGGGAGCGGATGCTC
ATGGGCTCGGAGGACAGCCTCACCCCGGCCAAGCTGGTGAACAGCCGCCCCTTGGAGGCC
GCCATCCGGGAGTTCTTCAGCCGCAGCCAGCTTTCCCAGTTCAAGGACGAGACCAACCCC
CTCTCCTCCCTGCGCCACAAGCGGCGGATCTCCGCCCTGGGCCCGGGCGGCCTCACCCGG
GAGCGGGCGGGGTTTGACGTGCGCGACGTCCACCGCACCCACTACGGGCGCATCTGCCCC
GTGGAGACCCCCGAGGGCGCCAACATCGGCCTCATCACCTCCTTGGCGGCCTACGCCCGG
GTGGACGAGCTGGGCTTCATCCGCACCCCCTACCGCCGGGTGGTGGGCGGGGTGGTCACC
GACGAGGTGGTCTACATGACGGCCACCGAGGAGGACCGCTACACCATCGCCCAGGCCAAC
ACCCCCCTGGAGGGGAACCGGATCGCGGCCGAGCGGGTGGTGGCCCGGAGGAAGGGGGAG
CCCGTGATCGTGAGCCCGGAAGAGGTGGAGTTCATGGACGTCTCCCCCAAGCAGGTCTTC
TCCGTGAACACCAACCTCATTCCCTTCCTGGAGCACGACGACGCCAACCGGGCCCTCATG
GGCTCCAACATGCAGACCCAGGCCGTGCCCCTCATCCGGGCCCAGGCCCCCGTGGTGATG
ACGGGCCTCGAGGAGCGGGTGGTGCGGGACTCCCTGGCCGCCCTCTACGCCGAGGAGGAC
GGGGAGGTGGCCAAGGTGGACGGCAACCGCATCGTCGTGCGCTACGAGGACGGCCGCCTG
GTGGAGTACCCCTTGCGCCGCTTCTACCGCTCCAACCAGGGTACGGCCCTGGACCAGCGC
CCCCGGGTGGTGGTGGGGCAGCGGGTGCGCAAAGGGGACCTCCTCGCCGACGGCCCCGCC
TCCGAGAACGGCTTCCTGGCCCTGGGGCAGAACGTCCTCGTGGCCATCATGCCCTTTGAC
GGGTACAACTTTGAGGACGCCATCGTCATCAGCGAGGAGCTCCTCAAGCGGGACTTCTAC
ACCTCCATCCACATTGAGCGCTACGAGATTGAGGCCCGGGACACCAAGCTTGGCCCCGAG
CGGATCACCCGGGACATCCCCCACCTCTCCGAGGCCGCCCTAAGGGACCTGGACGAGGAG
GGCGTGGTGCGCATCGGCGCCGAGGTGAAGCCCGGGGACATCCTCGTGGGGCGGACCAGC
TTCAAGGGCGAGTCCGAGCCCACCCCCGAGGAGAGGCTCCTCCGCTCCATCTTCGGCGAG
AAGGCCCGGGACGTGAAGGACACCTCCCTCCGGGTGCCGCCCGGCGAAGGGGGGATCGTG
GTCCGCACCGTCCGGCTGCGGCGGGGCGACCCCGGGGTGGAGCTCAAGCCCGGGGTGCGG
GAGGTGGTCCGGGTCTACGTGGCCCAGAAGCGCAAGCTCCAGGTGGGGGACAAGCTCGCC
AACCGCCACGGGAACAAGGGGGTGGTGGCCAAGATCCTCCCCGTGGAGGACATGCCCCAC
CTGCCCGACGGCACCCCCGTGGACGTGATCCTGAACCCCCTGGGCGTCCCCAGCCGGATG
AACCTGGGGCAGATCCTGGAGACCCACCTGGGCCTCGCCGGGTACTTCCTGGGCCAGCGC
TACATCTCCCCCATCTTTGACGGGGCCAAGGAGCCCGAGATCAAGGAGCTCCTCGCCCAG
GCCTTTGAGGTCTACTTCGGCAAGCGCAAGGGCGAGGGCTTCGGCGTGGACAAGCGGGAG
GTGGAGGTCCTCCGCCGGGCGGAGAAGCTCGGCCTCGTCACCCCGGGCAAGACCCCGGAG
GAGCAGCTTAAGGAGCTCTTCCTCCAGGGCAAGGTGGTCCTCTACGACGGCCGCACGGGC
GAGCCCATTGAGGGCCCCATCGTGGTGGGACAGATGTTCATCATGAAGCTCTACCACATG
GTGGAGGACAAGATGCACGCCCGCTCCACGGGGCCCTACTCCCTCATCACCCAGCAGCCC
CTGGGCGGGAAGGCCCAGTTCGGCGGCCAGCGCTTCGGGGAGATGGAGGTCTGGGCCCTC
GAGGCCTATGGGGCGGCCCACACCCTCCAGGAGATGCTCACCCTTAAGTCCGACGACATT
GAGGGCAGGAACGCCGCCTACGAGGCCATCATCAAGGGGGAGGACGTTCCCGAGCCCAGC
GTCCCCGAGTCCTTCCGCGTGCTGGTGAAGGAGCTCCAGGCCTTGGCCTTGGACGTGCAG
ACCCTGGACGAGAAGGACAACCCCGTGGACATCTTTGAGGGGTTGGCCTCCAAGCGGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8RQE9
UniProtKB Entry NameRPOB_THET8
GenBank Gene IDAB083789
General References
  1. Vassylyeva MN, Lee J, Sekine SI, Laptenko O, Kuramitsu S, Shibata T, Inoue Y, Borukhov S, Vassylyev DG, Yokoyama S: Purification, crystallization and initial crystallographic analysis of RNA polymerase holoenzyme from Thermus thermophilus. Acta Crystallogr D Biol Crystallogr. 2002 Sep;58(Pt 9):1497-500. Epub 2002 Aug 23. [PubMed:12198314]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04788TagetitoxinexperimentalunknownDetails
DB08226Myxopyronin BexperimentalunknownDetails
DB08266Methyl [(1E,5R)-5-{3-[(2E,4E)-2,5-dimethyl-2,4-octadienoyl]-2,4-dioxo-3,4-dihydro-2H-pyran-6-yl}hexylidene]carbamateexperimentalunknownDetails