Monocarboxylate transporter 10

Details

Name
Monocarboxylate transporter 10
Synonyms
  • Aromatic amino acid transporter 1
  • MCT 10
  • MCT10
  • Solute carrier family 16 member 10
  • T-type amino acid transporter 1
  • TAT1
Gene Name
SLC16A10
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007022|Monocarboxylate transporter 10
MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHE
PPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSL
SMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGC
SFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF
MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI
PLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVY
LQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREI
SKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII
Number of residues
515
Molecular Weight
55492.07
Theoretical pI
7.77
GO Classification
Functions
aromatic amino acid transmembrane transporter activity / thyroid hormone transmembrane transporter activity / transporter activity
Processes
amino acid transport / aromatic amino acid transport / ion transmembrane transport / ion transport / transmembrane transport
Components
basolateral plasma membrane / integral component of membrane / integral component of plasma membrane / plasma membrane
General Function
Transporter activity
Specific Function
Sodium-independent transporter that mediates the update of aromatic acid. Can function as a net efflux pathway for aromatic amino acids in the basosolateral epithelial cells (By similarity).
Pfam Domain Function
Transmembrane Regions
67-87 115-135 145-165 172-192 201-221 229-249 292-312 330-350 352-372 397-417 420-440 452-472
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020707|Monocarboxylate transporter 10 (SLC16A10)
ATGGTGCTCTCCCAGGAGGAGCCGGACTCCGCGCGGGGCACGAGCGAGGCGCAGCCGCTC
GGCCCCGCGCCCACGGGGGCCGCTCCGCCGCCCGGCCCGGGACCCTCGGACAGCCCCGAG
GCGGCTGTCGAGAAGGTGGAGGTGGAGCTGGCGGGGCCGGCGACCGCGGAGCCCCATGAG
CCCCCCGAACCCCCCGAGGGCGGCTGGGGCTGGCTGGTGATGCTGGCGGCCATGTGGTGC
AACGGGTCGGTGTTCGGCATCCAGAACGCTTGCGGGGTGCTCTTCGTGTCCATGCTGGAA
ACCTTCGGCTCCAAAGACGATGACAAGATGGTCTTTAAGACAGCATGGGTAGGTTCTCTC
TCCATGGGGATGATTTTCTTTTGCTGCCCAATAGTCAGCGTCTTCACAGACCTATTTGGT
TGTCGGAAAACAGCTGTCGTGGGTGCTGCTGTTGGATTTGTTGGGCTCATGTCCAGTTCT
TTTGTAAGTTCCATCGAGCCTCTGTACCTTACCTATGGAATCATATTTGCCTGCGGCTGC
TCCTTTGCATACCAGCCTTCATTGGTCATTTTGGGACACTATTTCAAGAAGCGCCTTGGA
CTGGTGAATGGCATTGTCACTGCTGGCAGCAGTGTCTTCACAATCCTGCTGCCTTTGCTC
TTAAGGGTTCTGATTGACAGCGTGGGCCTCTTTTACACATTGAGGGTGCTCTGCATCTTC
ATGTTTGTTCTCTTTCTGGCTGGCTTTACTTACCGACCTCTTGCTACCAGTACCAAAGAT
AAAGAGAGTGGAGGTAGCGGATCCTCCCTCTTTTCCAGGAAAAAGTTCAGTCCTCCAAAA
AAAATTTTCAATTTTGCCATCTTCAAGGTGACAGCTTATGCAGTGTGGGCAGTTGGAATA
CCACTTGCACTTTTTGGATACTTTGTGCCTTATGTTCACTTGATGAAACATGTAAATGAA
AGATTTCAAGATGAAAAAAATAAAGAGGTTGTTCTCATGTGCATTGGCGTCACTTCAGGA
GTTGGACGACTGCTCTTTGGCCGGATTGCAGATTATGTGCCTGGTGTGAAGAAGGTTTAT
CTACAGGTACTCTCCTTTTTCTTCATTGGTCTGATGTCCATGATGATTCCTCTGTGTAGC
ATCTTTGGGGCCCTCATTGCTGTGTGCCTCATCATGGGTCTCTTCGATGGATGCTTCATT
TCCATTATGGCTCCCATAGCCTTTGAGTTAGTTGGTGCCCAGGATGTCTCCCAAGCAATT
GGATTTCTGCTCGGATTCATGTCTATACCCATGACTGTTGGCCCACCCATTGCAGGGTTA
CTTCGTGACAAACTGGGCTCCTATGATGTGGCATTCTACCTCGCTGGAGTCCCTCCCCTT
ATTGGAGGTGCTGTGCTTTGTTTTATCCCGTGGATCCATAGTAAGAAGCAAAGAGAGATC
AGTAAAACCACTGGAAAAGAAAAGATGGAGAAAATGTTGGAAAACCAGAACTCTCTGCTG
TCAAGTTCATCTGGAATGTTCAAGAAAGAATCTGACTCTATTATTTAA
Chromosome Location
6
Locus
6q21-q22
External Identifiers
ResourceLink
UniProtKB IDQ8TF71
UniProtKB Entry NameMOT10_HUMAN
GenBank Protein ID18640047
GenBank Gene IDAB057445
HGNC IDHGNC:17027
General References
  1. Kim DK, Kanai Y, Matsuo H, Kim JY, Chairoungdua A, Kobayashi Y, Enomoto A, Cha SH, Goya T, Endou H: The human T-type amino acid transporter-1: characterization, gene organization, and chromosomal location. Genomics. 2002 Jan;79(1):95-103. [PubMed:11827462]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00135Tyrosineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00120L-Phenylalanineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00150L-Tryptophanapproved, nutraceutical, withdrawnunknowninhibitorDetails
DB00149L-Leucineapproved, nutraceuticalunknowninhibitorDetails
DB00279Liothyronineapproved, vet_approvedunknowninhibitorDetails
DB06262Droxidopaapproved, investigationalunknowninhibitorDetails
DB01235LevodopaapprovedunknowninhibitorDetails
DB00119Pyruvic acidapproved, investigational, nutraceuticalunknownsubstrateinhibitorDetails
DB04398Lactic acidapproved, vet_approvedunknownsubstrateinhibitorDetails
DB03225D-TryptophanexperimentalunknowninhibitorDetails
DB03839D-TyrosineexperimentalunknowninhibitorDetails
DB02556D-PhenylalanineexperimentalunknownsubstrateinhibitorDetails
DB01746D-LeucineexperimentalunknowninhibitorDetails
DB03929D-Serineapproved, experimentalunknowninhibitorDetails
DB01786D-AlanineexperimentalunknowninhibitorDetails
DB00138Cystineapproved, nutraceuticalunknowninhibitorDetails
DB00172Prolineapproved, nutraceuticalunknowninhibitorDetails
DB00125L-Arginineapproved, nutraceuticalunknowninhibitorDetails
DB00123L-Lysineapproved, nutraceuticalunknownsubstrateinhibitorDetails
DB00142Glutamic acidapproved, nutraceuticalunknownsubstrateinhibitorDetails
DB00128Aspartic acidapproved, nutraceuticalunknowninhibitorDetails
DB00117Histidineapproved, nutraceuticalunknownsubstrateinhibitorDetails
DB00161L-Valineapproved, nutraceuticalunknowninhibitorDetails
DB00167Isoleucineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00134Methionineapproved, nutraceuticalunknowninhibitorDetails
DB00130L-Glutamineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00174Asparagineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00151L-Cysteineapproved, nutraceuticalunknowninhibitorDetails
DB00156L-Threonineapproved, nutraceuticalunknowninhibitorDetails
DB00133Serineapproved, nutraceuticalunknowninhibitorDetails
DB00160L-Alanineapproved, nutraceuticalunknowninhibitorDetails
DB00145Glycineapproved, nutraceutical, vet_approvedunknownsubstrateinhibitorDetails
DB03107Beta-AlanineexperimentalunknownsubstrateDetails
DB02952Alpha-Aminoisobutyric AcidexperimentalunknownsubstrateDetails
DB01583LiotrixapprovedunknowninhibitorDetails