Choline transporter-like protein 1

Details

Name
Choline transporter-like protein 1
Synonyms
  • CD92
  • CDW92
  • CTL1
  • Solute carrier family 44 member 1
Gene Name
SLC44A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002109|Choline transporter-like protein 1
MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVS
GYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQ
ELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVN
ISCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVLSMILMVIIRYISRVL
VWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQIAEDNLRALLIYAISATVFT
VILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWVYWIMTLLFLG
TTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDK
RNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLK
SCICCLWCLEKCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFML
FLGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLC
FAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASSA
Number of residues
657
Molecular Weight
73301.28
Theoretical pI
8.69
GO Classification
Functions
choline transmembrane transporter activity
Processes
choline transport / glycerophospholipid biosynthetic process / phosphatidylcholine biosynthetic process / phospholipid metabolic process / small molecule metabolic process / transmembrane transport
Components
extracellular exosome / integral component of membrane / membrane / mitochondrial outer membrane / mitochondrion / nucleoplasm / plasma membrane
General Function
Choline transmembrane transporter activity
Specific Function
Choline transporter. May be involved in membrane synthesis and myelin production.
Pfam Domain Function
Transmembrane Regions
31-51 213-233 239-259 289-309 316-336 339-359 381-401 538-558 567-587
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010743|Choline transporter-like protein 1 (SLC44A1)
ATGGGCTGCTGCAGCTCCGCCTCCTCCGCCGCGCAGAGCTCCAAACGAGAATGGAAGCCG
CTGGAGGACCGTAGCTGCACAGACATACCATGGCTGCTGCTCTTCATCCTCTTCTGCATT
GGGATGGGATTTATTTGTGGCTTTTCAATAGCAACAGGTGCAGCAGCAAGACTAGTGTCA
GGATACGACAGCTATGGAAATATCTGTGGGCAGAAAAATACAAAGTTGGAAGCAATACCA
AACAGTGGCATGGACCACACCCAGCGGAAGTATGTATTCTTTTTGGATCCATGCAACCTG
GACTTGATAAACCGGAAGATTAAGTCTGTAGCACTGTGTGTAGCAGCGTGTCCAAGGCAA
GAACTGAAAACTCTGAGTGATGTTCAGAAGTTTGCAGAGATAAATGGTTCAGCCCTATGT
AGCTACAACCTAAAGCCTTCTGAATACACTACATCTCCAAAATCTTCTGTTCTCTGCCCC
AAACTACCAGTTCCAGCGAGTGCACCTATTCCATTCTTCCATCGCTGTGCTCCTGTGAAC
ATTTCCTGCTATGCCAAGTTTGCAGAGGCCCTGATCACCTTTGTCAGTGACAATAGTGTC
TTACACAGGCTGATTAGTGGAGTAATGACCAGCAAAGAAATTATATTGGGACTTTGCTTG
TTATCACTAGTTCTATCCATGATTTTGATGGTGATAATCAGGTATATATCAAGAGTACTT
GTGTGGATCTTAACGATTCTGGTCATACTCGGTTCACTTGGAGGCACAGGTGTACTATGG
TGGCTGTATGCAAAGCAAAGAAGGTCTCCCAAAGAAACTGTTACTCCTGAGCAGCTTCAG
ATAGCTGAAGACAATCTTCGGGCCCTCCTCATTTATGCCATTTCAGCTACAGTGTTCACA
GTGATCTTATTCCTGATAATGTTGGTTATGCGCAAACGTGTTGCTCTTACCATCGCCTTG
TTCCACGTAGCTGGCAAGGTCTTCATTCACTTGCCACTGCTAGTCTTCCAACCCTTCTGG
ACTTTCTTTGCTCTTGTCTTGTTTTGGGTGTACTGGATCATGACACTTCTTTTTCTTGGC
ACTACCGGCAGTCCTGTTCAGAATGAGCAAGGCTTTGTGGAGTTCAAAATTTCTGGGCCT
CTGCAGTACATGTGGTGGTACCATGTGGTGGGCCTGATTTGGATCAGTGAATTTATTCTA
GCATGTCAGCAGATGACAGTGGCAGGAGCTGTGGTAACATACTATTTTACTAGGGATAAA
AGGAATTTGCCATTTACACCTATTTTGGCATCAGTAAATCGCCTTATTCGTTACCACCTA
GGTACGGTGGCAAAAGGATCTTTCATTATCACATTAGTCAAAATTCCGCGAATGATCCTT
ATGTATATTCACAGTCAGCTCAAAGGAAAGGAAAATGCTTGTGCACGATGTGTGCTGAAA
TCTTGCATTTGTTGCCTTTGGTGTCTTGAAAAGTGCCTAAATTATTTAAATCAGAATGCA
TACACAGCCACAGCTATCAACAGCACCAACTTCTGCACCTCAGCAAAGGATGCCTTTGTC
ATTCTGGTGGAGAATGCTTTGCGAGTGGCTACCATCAACACAGTAGGAGATTTTATGTTA
TTCCTTGGCAAGGTGCTGATAGTCTGCAGCACAGGTTTAGCTGGGATTATGCTGCTCAAC
TACCAGCAGGACTACACAGTATGGGTGCTGCCTCTGATCATCGTCTGCCTCTTTGCTTTC
CTAGTCGCTCATTGCTTCCTGTCTATTTATGAAATGGTAGTGGATGTATTATTCTTGTGT
TTTGCCATTGATACAAAATACAATGATGGGAGCCCTGGCAGAGAATTCTATATGGATAAA
GTGCTGATGGAGTTTGTGGAAAACAGTAGGAAAGCAATGAAAGAAGCTGGTAAGGGAGGC
GTCGCTGATTCCAGAGAGCTAAAGCCGATGATTAAGTAA
Chromosome Location
9
Locus
9q31.2
External Identifiers
ResourceLink
UniProtKB IDQ8WWI5
UniProtKB Entry NameCTL1_HUMAN
GenBank Protein ID19571182
GenBank Gene IDAJ245620
GenAtlas IDSLC44A1
HGNC IDHGNC:18798
General References
  1. O'Regan S, Traiffort E, Ruat M, Cha N, Compaore D, Meunier FM: An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins. Proc Natl Acad Sci U S A. 2000 Feb 15;97(4):1835-40. [PubMed:10677542]
  2. Wille S, Szekeres A, Majdic O, Prager E, Staffler G, Stockl J, Kunthalert D, Prieschl EE, Baumruker T, Burtscher H, Zlabinger GJ, Knapp W, Stockinger H: Characterization of CDw92 as a member of the choline transporter-like protein family regulated specifically on dendritic cells. J Immunol. 2001 Nov 15;167(10):5795-804. [PubMed:11698453]
  3. Traiffort E, Ruat M, O'Regan S, Meunier FM: Molecular characterization of the family of choline transporter-like proteins and their splice variants. J Neurochem. 2005 Mar;92(5):1116-25. [PubMed:15715662]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  7. Michel V, Bakovic M: The solute carrier 44A1 is a mitochondrial protein and mediates choline transport. FASEB J. 2009 Aug;23(8):2749-58. doi: 10.1096/fj.08-121491. Epub 2009 Apr 8. [PubMed:19357133]
  8. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. [PubMed:22223895]
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  10. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00122Cholineapproved, nutraceuticalunknownsubstrateDetails
DB14006Choline salicylateapproved, nutraceuticalunknownsubstrateDetails