5-hydroxytryptamine receptor 3C

Details

Name
5-hydroxytryptamine receptor 3C
Synonyms
  • 5-HT3-C
  • Serotonin receptor 3C
Gene Name
HTR3C
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017548|5-hydroxytryptamine receptor 3C
MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNY
SIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENL
WLPDIFIVESMDVDQTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF
SSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFY
VAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLL
PASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLLHCTSPGRC
CPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH
AMDTLLFRLYLLFMASSILTVIVLWNT
Number of residues
447
Molecular Weight
50219.07
Theoretical pI
Not Available
GO Classification
Functions
serotonin receptor activity / serotonin-activated cation-selective channel activity
Processes
cation transmembrane transport / ion transmembrane transport / neurological system process / regulation of membrane potential / serotonin receptor signaling pathway / transmembrane transport
Components
integral component of membrane / neuron projection / plasma membrane / synapse
General Function
Serotonin-activated cation-selective channel activity
Specific Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Pfam Domain Function
Transmembrane Regions
249-269 283-303 307-329 425-445
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017549|5-hydroxytryptamine receptor 3C (HTR3C)
ATGGAAGGAGGGTGGCCTGCAAGGCAGAGTGCCCTCCTCTGCCTCACTGTCAGTCTTCTG
CTTCAAGGAAGAGGCGACGCTTTTACCATCAATTGCTCAGGCTTTGACCAGCATGGGGTT
GACCCTGCTGTCTTCCAAGCAGTGTTTGACAGAAAGGCCTTCCGTCCATTCACCAACTAC
AGCATCCCTACCCGTGTCAACATCTCCTTCACCCTGTCTGCCATCCTGGGAGTGGATGCA
CAGCTCCAGCTGCTGACATCATTCCTGTGGATGGATTTGGTATGGGACAATCCTTTCATT
AATTGGAACCCAAAAGAGTGTGTTGGCATCAATAAACTCACAGTATTAGCTGAAAACCTG
TGGCTCCCAGACATCTTCATCGTGGAATCCATGGATGTGGATCAGACGCCTTCCGGTCTC
ACTGCCTATATCAGCAGTGAAGGTCGAATTAAGTATGATAAGCCAATGAGGGTGACCAGC
ATCTGTAACCTGGACATCTTCTACTTCCCTTTTGACCAACAGAACTGTACCTTCACCTTC
AGTTCTTTCCTCTACACAGTGGACAGCATGCTGCTGGGCATGGACAAGGAGGTGTGGGAG
ATCACAGACACGTCTCGCAAAGTCATCCAAACCCAGGGGGAGTGGGAGCTCTTGGGCATC
AACAAGGCCACCCCAAAGATGTCCATGGGCAACAACCTATATGACCAGATCATGTTTTAT
GTGGCCATCAGGCGCAGGCCAAGCCTCTACATCATAAACCTGCTGGTGCCCAGTAGCTTT
CTGGTTGCCATTGATGCCCTCAGCTTCTACCTGCCAGCAGAGAGCGAGAATCGTGCCCCA
TTCAAGATAACACTTCTGCTGGGCTACAACGTCTTCCTGCTCATGATGAATGACTTGCTC
CCTGCCAGTGGCACCCCCCTCATCAGTGTCTACTTCGCCCTGTGCCTGTCCCTGATGGTG
GTCAGCCTGCTGGAGACCGTCTTCATTACCTACCTGCTGCACGTGGCCACCACCCAGCCC
CCACCCATGCCTAGGTGGCTTCACTCCCTGCTGCTCCACTGCACCAGCCCAGGGAGATGC
TGTCCCACTGCGCCCCAGAAGGGAAATAAGGGCCTGGGTCTCACCCTCACCCACCTGCCT
GGCCCAAAGGAGCCGGGGGAGTTAGCAGGGAAGAAGCTGGGACCCAGAGAGACCGAGCCA
GATGGGGGCTCAGGATGGACAAAGACCCAGCTAATGGAGCTGTGGGTGCAGTTCAGCCAC
GCGATGGACACCCTGCTCTTCCGCCTCTACCTGCTCTTCATGGCCTCCTCCATCCTTACT
GTCATTGTCCTCTGGAACACCTAG
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8WXA8
UniProtKB Entry Name5HT3C_HUMAN
HGNC IDHGNC:24003
General References
  1. Niesler B, Frank B, Kapeller J, Rappold GA: Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E. Gene. 2003 May 22;310:101-11. [PubMed:12801637]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Niesler B, Walstab J, Combrink S, Moller D, Kapeller J, Rietdorf J, Bonisch H, Gothert M, Rappold G, Bruss M: Characterization of the novel human serotonin receptor subunits 5-HT3C,5-HT3D, and 5-HT3E. Mol Pharmacol. 2007 Jul;72(1):8-17. Epub 2007 Mar 28. [PubMed:17392525]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB09304SetiptilineexperimentalunknownantagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB12141Gilteritinibapproved, investigationalnoinhibitorDetails
DB00715Paroxetineapproved, investigationalunknownDetails
DB00898EthanolapprovedunknownDetails