Growth hormone secretagogue receptor type 1
Details
- Name
- Growth hormone secretagogue receptor type 1
- Synonyms
- GH-releasing peptide receptor
- Ghrelin receptor
- GHRP
- GHS-R
- Gene Name
- GHSR
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0006601|Growth hormone secretagogue receptor type 1 MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT ESSINT
- Number of residues
- 366
- Molecular Weight
- 41328.045
- Theoretical pI
- 8.4
- GO Classification
- FunctionsG-protein coupled receptor activity / growth hormone secretagogue receptor activity / growth hormone-releasing hormone receptor activity / peptide hormone bindingProcessesactin polymerization or depolymerization / adult feeding behavior / cellular response to insulin stimulus / decidualization / G-protein coupled receptor signaling pathway / growth hormone secretion / hormone-mediated signaling pathway / negative regulation of inflammatory response / negative regulation of insulin secretion / negative regulation of interleukin-1 beta production / negative regulation of interleukin-6 biosynthetic process / negative regulation of tumor necrosis factor biosynthetic process / positive regulation of appetite / positive regulation of fatty acid metabolic process / positive regulation of insulin-like growth factor receptor signaling pathway / positive regulation of multicellular organism growth / regulation of hindgut contraction / regulation of synapse assembly / response to food / response to hormoneComponentscell surface / integral component of membrane / membrane raft / neuron projection / plasma membrane
- General Function
- Peptide hormone binding
- Specific Function
- Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 41-66 73-96 118-139 163-183 212-235 264-285 303-326
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0017083|Growth hormone secretagogue receptor type 1 (GHSR) ATGTGGAACGCGACGCCCAGCGAAGAGCCGGGGTTCAACCTCACACTGGCCGACCTGGAC TGGGATGCTTCCCCCGGCAACGACTCGCTGGGCGACGAGCTGCTGCAGCTCTTCCCCGCG CCGCTGCTGGCGGGCGTCACAGCCACCTGCGTGGCACTCTTCGTGGTGGGCATCGCTGGC AACCTGCTCACCATGCTGGTGGTGTCGCGCTTCCGCGAGCTGCGCACCACCACCAACCTC TACCTGTCCAGCATGGCCTTCTCCGATCTGCTCATCTTCCTCTGCATGCCCCTGGACCTC GTTCGCCTCTGGCAGTACCGGCCCTGGAACTTCGGCGACCTCCTCTGCAAACTCTTCCAA TTCGTCAGTGAGAGCTGCACCTACGCCACGGTGCTCACCATCACAGCGCTGAGCGTCGAG CGCTACTTCGCCATCTGCTTCCCACTCCGGGCCAAGGTGGTGGTCACCAAGGGGCGGGTG AAGCTGGTCATCTTCGTCATCTGGGCCGTGGCCTTCTGCAGCGCCGGGCCCATCTTCGTG CTAGTCGGGGTGGAGCACGAGAACGGCACCGACCCTTGGGACACCAACGAGTGCCGCCCC ACCGAGTTTGCGGTGCGCTCTGGACTGCTCACGGTCATGGTGTGGGTGTCCAGCATCTTC TTCTTCCTTCCTGTCTTCTGTCTCACGGTCCTCTACAGTCTCATCGGCAGGAAGCTGTGG CGGAGGAGGCGCGGCGATGCTGTCGTGGGTGCCTCGCTCAGGGACCAGAACCACAAGCAA ACCGTGAAAATGCTGGGTGGGTCTCAGCGCGCGCTCAGGCTTTCTCTCGCGGGTCCTATC CTCTCCCTGTGCCTTCTCCCTTCTCTCTGA
- Chromosome Location
- 3
- Locus
- 3q26.31
- External Identifiers
Resource Link UniProtKB ID Q92847 UniProtKB Entry Name GHSR_HUMAN GenBank Gene ID U60179 GenAtlas ID GHSR HGNC ID HGNC:4267 - General References
- Howard AD, Feighner SD, Cully DF, Arena JP, Liberator PA, Rosenblum CI, Hamelin M, Hreniuk DL, Palyha OC, Anderson J, Paress PS, Diaz C, Chou M, Liu KK, McKee KK, Pong SS, Chaung LY, Elbrecht A, Dashkevicz M, Heavens R, Rigby M, Sirinathsinghji DJ, Dean DC, Melillo DG, Patchett AA, Nargund R, Griffin PR, DeMartino JA, Gupta SK, Schaeffer JM, Smith RG, Van der Ploeg LH: A receptor in pituitary and hypothalamus that functions in growth hormone release. Science. 1996 Aug 16;273(5277):974-7. [Article]
- Petersenn S, Rasch AC, Penshorn M, Beil FU, Schulte HM: Genomic structure and transcriptional regulation of the human growth hormone secretagogue receptor. Endocrinology. 2001 Jun;142(6):2649-59. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Smith RG, Leonard R, Bailey AR, Palyha O, Feighner S, Tan C, Mckee KK, Pong SS, Griffin P, Howard A: Growth hormone secretagogue receptor family members and ligands. Endocrine. 2001 Feb;14(1):9-14. [Article]
- Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H, Kangawa K: Ghrelin is a growth-hormone-releasing acylated peptide from stomach. Nature. 1999 Dec 9;402(6762):656-60. [Article]
- Pantel J, Legendre M, Cabrol S, Hilal L, Hajaji Y, Morisset S, Nivot S, Vie-Luton MP, Grouselle D, de Kerdanet M, Kadiri A, Epelbaum J, Le Bouc Y, Amselem S: Loss of constitutive activity of the growth hormone secretagogue receptor in familial short stature. J Clin Invest. 2006 Mar;116(3):760-8. [Article]
- Pantel J, Legendre M, Nivot S, Morisset S, Vie-Luton MP, le Bouc Y, Epelbaum J, Amselem S: Recessive isolated growth hormone deficiency and mutations in the ghrelin receptor. J Clin Endocrinol Metab. 2009 Nov;94(11):4334-41. doi: 10.1210/jc.2009-1327. Epub 2009 Sep 29. [Article]