Metallothionein-1L
Details
- Name
- Metallothionein-1L
- Synonyms
- Metallothionein-IL
- MT-1L
- MT-IL
- Gene Name
- MT1L
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0049465|Metallothionein-1L MDPNCSCATGGSCSCASSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCVCKGASEKCSCC A
- Number of residues
- 61
- Molecular Weight
- 6062.11
- Theoretical pI
- Not Available
- GO Classification
- Functionszinc ion bindingProcessescellular response to zinc ion / negative regulation of growthComponentscytoplasm / nucleus / perinuclear region of cytoplasm
- General Function
- Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
- Specific Function
- Zinc ion binding
- Pfam Domain Function
- Metallothio (PF00131)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q93083 UniProtKB Entry Name MT1L_HUMAN HGNC ID HGNC:7404 - General References
- Lambert E, Kille P, Swaminathan R: Cloning and sequencing a novel metallothionein I isoform expressed in human reticulocytes. FEBS Lett. 1996 Jul 1;389(2):210-2. [Article]