Protease

Details

Name
Protease
Synonyms
Not Available
Gene Name
PROF
Organism
Bacillus sp. KSM-KP43
Amino acid sequence
>lcl|BSEQ0022294|Protease
MRKKKKVFLSVLSAAAILSTVALSNPSAGGARNFDLDFKGIQTTTDAKGFSKQGQTGAAA
FLVESENVKLPKGLQKKLETVPANNKLHIIQFNGPILEETKQQLEKTGAKILDYIPDYAY
IVEYEGDVKSATSTIEHVESVEPYLPIYRIDPQLFTKGASELVKAVALDTKQKNKEVQLR
GIEQIAQFAISNDVLYITAKPEYKVMNDVARGIVKADVAQSSYGLYGQGQIVAVADTGLD
TGRNDSSMHEAFRGKITALYALGRTNNANDTNGHGTHVAGSVLGNGSTNKGMAPQANLVF
QSIMDSGGGLGGLPSNLQTLFSQAYSAGARIHTNSWGAAVNGAYTTDSRNVDDYVRKNDM
TILFAAGNEGPNGGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTKDG
RIKPDVMAPGTFILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVK
NRGITPKPSLLKAALIAGAADIGLGYPNGNQGWGRVTLDKSLNVAYVNESSSLSTSQKAT
YSFTATAGKPLKISLVWSDAPASTTASVTLVNDLDLVITAPNGTQYVGNDFTSPYNDNWD
GRNNVENVFINAPQSGTYTIEVQAYNVPVGPQTFSLAIVN
Number of residues
640
Molecular Weight
67990.745
Theoretical pI
8.78
GO Classification
Functions
metal ion binding / serine-type endopeptidase activity
General Function
Serine-type endopeptidase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0005322|1923 bp
ATGAGAAAGAAGAAAAAGGTGTTTTTATCTGTTTTATCAGCTGCAGCGATTTTGTCGACT
GTTGCGTTAAGTAATCCATCTGCAGGTGGTGCAAGGAATTTTGATCTGGATTTCAAAGGA
ATTCAGACAACAACTGATGCTAAAGGTTTCTCCAAGCAGGGGCAGACTGGTGCTGCTGCT
TTTCTGGTGGAATCTGAAAATGTGAAACTCCCAAAAGGTTTGCAGAAGAAGCTTGAAACA
GTCCCGGCAAATAATAAACTCCATATTATCCAATTCAATGGACCAATTTTAGAAGAAACA
AAACAGCAGCTGGAAAAAACAGGGGCAAAGATTCTCGACTACATACCTGATTATGCTTAC
ATTGTCGAGTATGAGGGCGATGTTAAGTCAGCAACAAGCACCATTGAGCACGTGGAATCC
GTGGAGCCTTATTTGCCGATATACAGAATAGATCCCCAGCTTTTCACAAAAGGGGCATCA
GAGCTTGTAAAAGCAGTGGCGCTTGATACAAAGCAGAAAAATAAAGAGGTGCAATTAAGA
GGCATCGAACAAATCGCACAATTCGCAATAAGCAATGATGTGCTATATATTACGGCAAAG
CCTGAGTATAAGGTGATGAATGATGTTGCGCGTGGAATTGTCAAAGCGGATGTGGCTCAG
AGCAGCTACGGGTTGTATGGACAAGGACAGATCGTAGCGGTTGCCGATACAGGGCTTGAT
ACAGGTCGCAATGACAGTTCGATGCATGAAGCCTTCCGCGGGAAAATTACTGCATTATAT
GCATTGGGACGGACGAATAATGCCAATGATACGAATGGTCATGGTACGCATGTGGCTGGC
TCCGTATTAGGAAACGGCTCCACTAATAAAGGAATGGCGCCTCAGGCGAATCTAGTCTTC
CAATCTATCATGGATAGCGGTGGGGGACTTGGAGGACTACCTTCGAATCTGCAAACCTTA
TTCAGCCAAGCATACAGTGCTGGTGCCAGAATTCATACAAACTCCTGGGGAGCAGCAGTG
AATGGGGCTTACACAACAGATTCCAGAAATGTGGATGACTATGTGCGCAAAAATGATATG
ACGATCCTTTTCGCTGCCGGGAATGAAGGACCGAACGGCGGAACCATCAGTGCACCAGGC
ACAGCTAAAAATGCAATAACAGTCGGAGCTACGGAAAACCTCCGCCCAAGCTTTGGGTCT
TATGCGGACAATATCAACCATGTGGCACAGTTCTCTTCACGTGGACCGACAAAGGATGGA
CGGATCAAACCGGATGTCATGGCACCGGGAACGTTCATACTATCAGCAAGATCTTCTCTT
GCACCGGATTCCTCCTTCTGGGCGAACCATGACAGTAAATATGCATACATGGGTGGAACG
TCCATGGCTACACCGATCGTTGCTGGAAACGTGGCACAGCTTCGTGAGCATTTTGTGAAA
AACAGAGGCATCACACCAAAGCCTTCTCTATTAAAAGCGGCACTGATTGCCGGTGCAGCT
GACATCGGCCTTGGCTACCCGAACGGTAACCAAGGATGGGGACGAGTGACATTGGATAAA
TCCCTGAACGTTGCCTATGTGAACGAGTCCAGTTCTCTATCCACCAGCCAAAAAGCGACG
TACTCGTTTACTGCTACTGCCGGCAAGCCTTTGAAAATCTCCCTGGTATGGTCTGATGCC
CCTGCGAGCACAACTGCTTCCGTAACGCTTGTCAATGATCTGGACCTTGTCATTACCGCT
CCAAATGGCACACAGTATGTAGGAAATGACTTTACTTCGCCATACAATGATAACTGGGAT
GGCCGCAATAACGTAGAAAATGTATTTATTAATGCACCACAAAGCGGGACGTATACAATT
GAGGTACAGGCTTATAACGTACCGGTTGGACCACAGACCTTCTCGTTGGCAATTGTGAAT
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ93UV9
UniProtKB Entry NameQ93UV9_9BACI
GenBank Gene IDAB051423
General References
  1. Nonaka T, Fujihashi M, Kita A, Saeki K, Ito S, Horikoshi K, Miki K: The crystal structure of an oxidatively stable subtilisin-like alkaline serine protease, KP-43, with a C-terminal beta-barrel domain. J Biol Chem. 2004 Nov 5;279(45):47344-51. Epub 2004 Sep 1. [PubMed:15342641]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02235L-methionine (R)-S-oxideexperimentalunknownDetails