Multidrug and toxin extrusion protein 1

Details

Name
Multidrug and toxin extrusion protein 1
Synonyms
  • MATE-1
  • MATE1
  • Solute carrier family 47 member 1
Gene Name
SLC47A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007028|Multidrug and toxin extrusion protein 1
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ
Number of residues
570
Molecular Weight
61921.585
Theoretical pI
7.62
GO Classification
Functions
drug transmembrane transporter activity / monovalent cation
Processes
drug transmembrane transport / organic cation transport / transmembrane transport
Components
integral component of membrane / membrane-bounded vesicle / plasma membrane
General Function
Monovalent cation:proton antiporter activity
Specific Function
Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium); a widely used herbicid. Responsible for the secretion of cationic drugs across the brush border membranes.
Pfam Domain Function
Transmembrane Regions
38-58 73-93 124-144 153-173 177-197 217-237 257-276 296-316 337-357 371-391 409-429 438-458 547-567
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017174|Multidrug and toxin extrusion protein 1 (SLC47A1)
ATGGAAGCTCCTGAGGAGCCCGCGCCAGTGCGCGGAGGCCCGGAGGCCACCCTTGAGGTC
CGTGGGTCGCGCTGCTTGCGGCTGTCCGCCTTCCGAGAAGAGCTGCGGGCGCTCTTGGTC
CTGGCTGGCCCCGCGTTCTTGGTTCAGCTGATGGTGTTCCTGATCAGCTTCATAAGCTCC
GTGTTCTGTGGCCACCTGGGCAAGCTGGAGCTGGATGCAGTCACGCTGGCAATCGCGGTT
ATCAATGTCACTGGTGTCTCAGTGGGATTCGGCTTATCTTCTGCCTGTGACACCCTCATC
TCCCAGACGTACGGGAGCCAGAACCTGAAGCACGTGGGCGTGATCCTGCAGCGGAGTGCG
CTCGTCCTGCTCCTCTGCTGCTTCCCCTGCTGGGCGCTCTTTCTCAACACCCAGCACATC
CTGCTGCTCTTCAGGCAGGACCCAGATGTGTCCAGGCTTACCCAGACCTATGTCACGATC
TTCATTCCAGCTCTTCCTGCAACCTTTCTTTATATGTTACAAGTTAAATATTTGCTCAAC
CAGGGAATTGTACTGCCCCAGATCGTAACTGGAGTTGCAGCCAACCTTGTCAATGCCCTC
GCCAACTATCTGTTTCTCCATCAACTGCATCTTGGGGTGATAGGCTCTGCACTGGCAAAC
TTGATTTCCCAGTACACCCTGGCTCTACTCCTCTTTCTCTACATCCTCGGGAAAAAACTG
CATCAAGCTACATGGGGAGGCTGGTCCCTCGAGTGCCTGCAGGACTGGGCCTCCTTCCTC
CGCCTGGCCATCCCCAGCATGCTCATGCTGTGCATGGAGTGGTGGGCCTATGAGGTCGGG
AGCTTCCTCAGTGGCATCCTCGGCATGGTGGAGCTGGGCGCTCAGTCCATCGTGTATGAA
CTGGCCATCATTGTGTACATGGTCCCTGCAGGCTTCAGTGTGGCTGCCAGTGTCCGGGTA
GGAAACGCTCTGGGTGCTGGAGACATGGAGCAGGCACGGAAGTCCTCTACCGTTTCCCTG
CTGATTACAGTGCTCTTTGCTGTAGCCTTCAGTGTCCTGCTGTTAAGCTGTAAGGATCAC
GTGGGGTACATTTTTACTACCGACCGAGACATCATTAATCTGGTGGCTCAGGTGGTTCCA
ATTTATGCTGTTTCCCACCTCTTTGAAGCTCTTGCTTGCACGAGTGGTGGTGTTCTGAGG
GGGAGTGGAAATCAGAAGGTTGGAGCCATTGTGAATACCATTGGGTACTATGTGGTTGGC
CTCCCCATCGGGATCGCGCTGATGTTTGCAACCACACTTGGAGTGATGGGTCTGTGGTCA
GGGATCATCATCTGTACAGTCTTTCAAGCTGTGTGTTTTCTAGGCTTTATTATTCAGCTA
AATTGGAAAAAAGCCTGTCAGCAGGCTCAGGTACACGCCAATTTGAAAGTAAACAACGTG
CCTCGGAGTGGGAATTCTGCTCTCCCTCAGGATCCGCTTCACCCAGGGTGCCCTGAAAAC
CTTGAAGGAATTTTAACGAACGATGTTGGAAAGACAGGCGAGCCTCAGTCAGATCAGCAG
ATGCGCCAAGAAGAACCTTTGCCGGAACATCCACAGGACGGCGCTAAATTGTCCAGGAAA
CAGCTGGTGCTGCGGCGAGGGCTTCTGCTCCTGGGGGTCTTCTTAATCTTGCTGGTGGGG
ATTTTAGTGAGATTCTATGTCAGAATTCAGTGA
Chromosome Location
17
Locus
17p11.2
External Identifiers
ResourceLink
UniProtKB IDQ96FL8
UniProtKB Entry NameS47A1_HUMAN
GenBank Protein ID7023138
GenBank Gene IDAK001709
HGNC IDHGNC:25588
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Otsuka M, Matsumoto T, Morimoto R, Arioka S, Omote H, Moriyama Y: A human transporter protein that mediates the final excretion step for toxic organic cations. Proc Natl Acad Sci U S A. 2005 Dec 13;102(50):17923-8. Epub 2005 Dec 5. [PubMed:16330770]
  4. Hiasa M, Matsumoto T, Komatsu T, Moriyama Y: Wide variety of locations for rodent MATE1, a transporter protein that mediates the final excretion step for toxic organic cations. Am J Physiol Cell Physiol. 2006 Oct;291(4):C678-86. Epub 2006 Apr 26. [PubMed:16641166]
  5. Omote H, Hiasa M, Matsumoto T, Otsuka M, Moriyama Y: The MATE proteins as fundamental transporters of metabolic and xenobiotic organic cations. Trends Pharmacol Sci. 2006 Nov;27(11):587-93. Epub 2006 Sep 25. [PubMed:16996621]
  6. Tanihara Y, Masuda S, Sato T, Katsura T, Ogawa O, Inui K: Substrate specificity of MATE1 and MATE2-K, human multidrug and toxin extrusions/H(+)-organic cation antiporters. Biochem Pharmacol. 2007 Jul 15;74(2):359-71. doi: 10.1016/j.bcp.2007.04.010. Epub 2007 Apr 13. [PubMed:17509534]
  7. Yokoo S, Yonezawa A, Masuda S, Fukatsu A, Katsura T, Inui K: Differential contribution of organic cation transporters, OCT2 and MATE1, in platinum agent-induced nephrotoxicity. Biochem Pharmacol. 2007 Aug 1;74(3):477-87. Epub 2007 Mar 12. [PubMed:17582384]
  8. Chen Y, Zhang S, Sorani M, Giacomini KM: Transport of paraquat by human organic cation transporters and multidrug and toxic compound extrusion family. J Pharmacol Exp Ther. 2007 Aug;322(2):695-700. Epub 2007 May 10. [PubMed:17495125]
  9. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00331MetforminapprovedunknownsubstrateDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateinhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedunknownsubstrateDetails
DB00877Sirolimusapproved, investigationalunknownDetails
DB00787AcyclovirapprovedunknownsubstrateDetails
DB08840N-methylnicotinamideexperimentalunknownsubstrateDetails
DB12001Abemaciclibapproved, investigationalunknowninhibitorDetails
DB09343Tipiracilapproved, investigationalnocarrierDetails
DB12267Brigatinibapproved, investigationalnoinhibitorDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB11799Bictegravirapproved, investigationalunknowninhibitorDetails
DB04948Lofexidineapproved, investigationalnoinhibitorDetails
DB12615Plazomicinapproved, investigationalunknowninhibitorDetails
DB06608Tafenoquineapproved, investigationalnoinhibitorDetails
DB01333CefradineapprovedunknownsubstrateDetails
DB01137Levofloxacinapproved, investigationalunknownsubstrateinhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknownsubstrateinhibitorDetails
DB04574Estrone sulfateapprovedunknownsubstrateDetails
DB01004Ganciclovirapproved, investigationalunknownsubstrateDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownsubstrateDetails
DB00536GuanidineapprovedunknownsubstrateDetails
DB01035ProcainamideapprovedunknownsubstrateDetails
DB01030Topotecanapproved, investigationalunknownsubstrateinhibitorDetails
DB00205Pyrimethamineapproved, investigational, vet_approvednoinhibitorDetails
DB11753Rifamycinapproved, investigationalnoinhibitorDetails
DB09343Tipiracilapproved, investigationalunknownsubstrateDetails
DB12141Gilteritinibapproved, investigationalnoinhibitorDetails
DB11978Glasdegibapproved, investigationalnoinhibitorDetails
DB13946Testosterone undecanoateapproved, investigationalunknownDetails
DB01043Memantineapproved, investigationalunknownDetails
DB12377Relebactamapproved, investigationalunknownsubstrateDetails
DB12978Pexidartinibapproved, investigationalunknowninhibitorDetails
DB01203NadololapprovedunknownsubstrateDetails
DB12500Fedratinibapproved, investigationalunknowninhibitorDetails
DB11757Istradefyllineapproved, investigationalunknowninhibitorDetails
DB01195Flecainideapproved, withdrawnunknownsubstrateinhibitorDetails
DB11901Apalutamideapproved, investigationalunknowninhibitorDetails
DB11732Lasmiditanapproved, investigationalunknowninhibitorDetails
DB00879Emtricitabineapproved, investigationalunknownsubstrateDetails
DB00661VerapamilapprovedunknowninhibitorDetails