Putative gonadotropin-releasing hormone II receptor

Details

Name
Putative gonadotropin-releasing hormone II receptor
Synonyms
  • GnRH II receptor
  • Type II GnRH receptor
Gene Name
GNRHR2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037024|Putative gonadotropin-releasing hormone II receptor
MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLG
SRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFT
FCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLAL
LILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGC
RRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Number of residues
292
Molecular Weight
32536.935
Theoretical pI
9.68
GO Classification
Functions
gonadotropin-releasing hormone receptor activity
Components
integral component of membrane / plasma membrane
General Function
Gonadotropin-releasing hormone receptor activity
Specific Function
Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional.
Pfam Domain Function
Transmembrane Regions
29-49 68-88 116-136 178-198 217-237
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0000942|1140 bp
CATGTCTGCAGGCAACGGCACCCCTTGGGGTCAGCAGCGGGGGAGGAGGTCTGGGCTGGA
TCAGGAGTGGAGGTGGAGGGCTCAGAGCTGCCCACCTTCTCGGCAGCAGCCAAGGTCCGA
GTGGGAGTGACCATTGTGCTGTTTGTTTCTTCGGCTGGAGGGAACCTGGCAGTCCTGTGG
TCAGTGACACGGCGGGAACCCAGCCAGCTCCGCCCCTCTCCGGTCAGGAGACTCTTCATC
CATTTAGCAGCCGCCGACTTACTAGTCACTTTTGTGGTTATGCCCCTAGATGCCACCTGG
AATATCACTGTTCAATGGCTGGCTGTGGACATCGCATGTCGGACACTGATGTTCCTGAAA
CTAATGGCCACGTATTCTGCAGCTTTCCTGCCTGTGGTCATTGGATTGGACCGCCAGGCA
GCAGTACTCAACCCGCTTGGATCCCGTTCAGGTGTAAGGAAACTTCTGGGGGCAGCCTGG
GGACTTAGTTTCCTGCTTGCCTTCCCCCAGCTGTTCCTGTTCCACACGGTCCACTGAGCT
GGCCCAGTCCCTTTCACTCAGTGTGTCACCAAAGGCAGCTTCAAGGCTCAATGGCAAGAG
ACCACCTATAACCTCTTCACCTTCTGCTGCCTCTTTCTGCTGCCACTGACTGCCATGGCC
ATCTGCTATAGCCGCATTGTCCTCAGTGTGTCCAGGCCCCAGACAAGGAAGGGGAGCCAT
GCCCCTGCTGGTGAATTTGCCCTCCCCCGCTCCTTTGACAATTGTCCCCGTGTTCGTCTC
CGGGCCCTGAGACTGGCCCTGCTTATCTTGCTGACCTTCATCCTCTGCTGGACACCTTAT
TACCTACTGGGTATGTGGTACTGGTTCTCCCCCACCATGCTAACTGAAGTCCCTCCCAGC
CTGAGCCACATCCTTTTCCTCTTGGGCCTCCTCAATGCTCCTTTGGATCCTCTCCTCTAT
GGGGCCTTCACCCTTGGCTGCCGAAGAGGGCACCAAGAACTTAGTATAGACTCTTCTAAA
GAAGGGTCTGGGAGAATGCTCCAAGAGGAGATTCATGCCTTTAGACAGCTGGAAGTACAA
AAAACTGTGACATCAAGAAGGGCAGGAGAAACAAAAGGCATTTCTATAACATCTATCTGA
Chromosome Location
Not Available
Locus
1q12
External Identifiers
ResourceLink
UniProtKB IDQ96P88
UniProtKB Entry NameGNRR2_HUMAN
GenBank Protein ID16589056
GenBank Gene IDAF403014
GenAtlas IDGNRHR2
HGNC IDHGNC:16341
General References
  1. Faurholm B, Millar RP, Katz AA: The genes encoding the type II gonadotropin-releasing hormone receptor and the ribonucleoprotein RBM8A in humans overlap in two genomic loci. Genomics. 2001 Nov;78(1-2):15-8. [PubMed:11707068]
  2. Neill JD: GnRH and GnRH receptor genes in the human genome. Endocrinology. 2002 Mar;143(3):737-43. [PubMed:11861490]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Morgan K, Conklin D, Pawson AJ, Sellar R, Ott TR, Millar RP: A transcriptionally active human type II gonadotropin-releasing hormone receptor gene homolog overlaps two genes in the antisense orientation on chromosome 1q.12. Endocrinology. 2003 Feb;144(2):423-36. [PubMed:12538601]
  5. Stewart AJ, Katz AA, Millar RP, Morgan K: Retention and silencing of prepro-GnRH-II and type II GnRH receptor genes in mammals. Neuroendocrinology. 2009;90(4):416-32. doi: 10.1159/000233303. Epub 2009 Aug 5. [PubMed:19657181]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00644Gonadorelinapproved, investigational, vet_approvedyesagonistDetails
DB00666NafarelinapprovedyesagonistDetails
DB01406Danazolapprovedyesnegative modulatorDetails