Cyclin-dependent kinase 15

Details

Name
Cyclin-dependent kinase 15
Synonyms
  • 2.7.11.22
  • ALS2CR7
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
  • Cell division protein kinase 15
  • PFTK2
  • Serine/threonine-protein kinase ALS2CR7
  • Serine/threonine-protein kinase PFTAIRE-2
Gene Name
CDK15
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037018|Cyclin-dependent kinase 15
MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGL
QAARAQKFKSKRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEA
EDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLA
SYQKGHHPAQFSKCW
Number of residues
435
Molecular Weight
49022.64
Theoretical pI
7.52
GO Classification
Functions
ATP binding / cyclin-dependent protein serine/threonine kinase activity / metal ion binding / protein serine/threonine kinase activity
General Function
Protein serine/threonine kinase activity
Specific Function
Serine/threonine-protein kinase that acts like an antiapoptotic protein that counters TRAIL/TNFSF10-induced apoptosis by inducing phosphorylation of BIRC5 at 'Thr-34'.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010304|Cyclin-dependent kinase 15 (CDK15)
ATGGGTCAAGAGCTGTGTGCAAAGACTGTACAGCCTGGATGCAGCTGCTACCATTGTTCA
GAGGGAGGCGAGGCACACAGCTGTCGGAGGAGTCAGCCTGAGACCACGGAGGCTGCGTTC
AAGCTAACAGACCTAAAAGAAGCATCATGTTCCATGACTTCATTTCACCCCAGGGGACTT
CAAGCTGCCCGTGCCCAGAAGTTCAAGAGTAAAAGGCCACGGAGTAACAGTGATTGTTTT
CAGGAAGAGGATCTGAGGCAGGGTTTTCAGTGGAGGAAGAGCCTCCCTTTTGGGGCAGCC
TCATCTTACTTGAACTTGGAGAAGCTGGGTGAAGGCTCTTATGCGACAGTTTACAAGGGG
ATTAGCAGAATAAATGGACAACTAGTGGCTTTAAAAGTCATCAGCATGAATGCAGAGGAA
GGAGTCCCATTTACAGCTATCCGAGAAGCTTCTCTCCTGAAGGGTTTGAAACATGCCAAT
ATTGTGCTCCTGCATGACATAATCCACACCAAAGAGACACTGACATTCGTTTTTGAATAC
ATGCACACAGACCTGGCCCAGTATATGTCTCAGCATCCAGGAGGGCTTCATCCTCATAAT
GTCAGACTTTTCATGTTTCAACTTTTGCGGGGCCTGGCGTACATCCACCACCAACACGTT
CTTCACAGGGACCTGAAACCTCAGAACTTACTCATCAGTCACCTGGGAGAGCTCAAACTG
GCTGATTTTGGTCTTGCCCGGGCCAAGTCCATTCCCAGCCAGACATACTCTTCAGAAGTC
GTGACCCTCTGGTACCGGCCCCCTGATGCTTTGCTGGGAGCCACTGAATATTCCTCTGAG
CTGGACATATGGGGTGCAGGCTGCATCTTTATTGAAATGTTCCAGGGTCAACCTTTGTTT
CCTGGGGTTTCCAACATCCTTGAACAGCTGGAGAAAATCTGGGAGGTGCTGGGAGTCCCT
ACAGAGGATACTTGGCCGGGAGTCTCCAAGCTACCTAACTACAATCCAGAATGGTTCCCA
CTGCCTACGCCTCGAAGCCTTCATGTTGTCTGGAACAGGCTGGGCAGGGTTCCTGAAGCT
GAAGACCTGGCCTCCCAGATGCTAAAAGGCTTTCCCAGAGACCGCGTCTCCGCCCAGGAA
GCACTTGTTCATGATTATTTCAGCGCCCTGCCATCTCAGCTGTACCAGCTTCCTGATGTT
TCAGGAGTGAGGCTAAAGCCAGAAATGTGTGACCTTTTGGCCTCCTACCAGAAAGGTCAC
CACCCAGCCCAGTTTAGCAAATGCTGGTGA
Chromosome Location
2
Locus
2q33.2
External Identifiers
ResourceLink
UniProtKB IDQ96Q40
UniProtKB Entry NameCDK15_HUMAN
GenBank Protein ID15823642
GenBank Gene IDAB053308
GenAtlas IDALS2CR7
HGNC IDHGNC:14434
General References
  1. Hadano S, Hand CK, Osuga H, Yanagisawa Y, Otomo A, Devon RS, Miyamoto N, Showguchi-Miyata J, Okada Y, Singaraja R, Figlewicz DA, Kwiatkowski T, Hosler BA, Sagie T, Skaug J, Nasir J, Brown RH Jr, Scherer SW, Rouleau GA, Hayden MR, Ikeda JE: A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2. Nat Genet. 2001 Oct;29(2):166-73. [PubMed:11586298]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Manning G, Whyte DB, Martinez R, Hunter T, Sudarsanam S: The protein kinase complement of the human genome. Science. 2002 Dec 6;298(5600):1912-34. [PubMed:12471243]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846]
  7. Park MH, Kim SY, Kim YJ, Chung YH: ALS2CR7 (CDK15) attenuates TRAIL induced apoptosis by inducing phosphorylation of survivin Thr34. Biochem Biophys Res Commun. 2014 Jul 18;450(1):129-34. doi: 10.1016/j.bbrc.2014.05.070. Epub 2014 May 24. [PubMed:24866247]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails
DB06486EnzastaurininvestigationalunknownDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails