Sphingosine 1-phosphate receptor 3

Details

Name
Sphingosine 1-phosphate receptor 3
Synonyms
  • EDG3
  • Endothelial differentiation G-protein coupled receptor 3
  • S1P receptor 3
  • S1P receptor Edg-3
  • Sphingosine 1-phosphate receptor Edg-3
Gene Name
S1PR3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052327|Sphingosine 1-phosphate receptor 3
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Number of residues
378
Molecular Weight
42249.805
Theoretical pI
Not Available
GO Classification
Functions
G protein-coupled receptor activity / integrin binding / lipid binding / sphingosine-1-phosphate receptor activity
Processes
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway / anatomical structure morphogenesis / cytokine production / G protein-coupled receptor signaling pathway / inflammatory response / negative regulation of establishment of endothelial barrier / Notch signaling pathway / positive regulation of cell population proliferation / positive regulation of cytosolic calcium ion concentration / regulation of interleukin-1 beta production
Components
cell / integral component of plasma membrane / plasma membrane
General Function
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
Specific Function
G protein-coupled receptor activity
Pfam Domain Function
Transmembrane Regions
41-65 73-101 116-134 154-179 196-216 244-265 282-302
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0052328|Sphingosine 1-phosphate receptor 3 (S1PR3)
ATGGCAACTGCCCTCCCGCCGCGTCTCCAGCCGGTGCGGGGGAACGAGACCCTGCGGGAG
CATTACCAGTACGTGGGGAAGTTGGCGGGCAGGCTGAAGGAGGCCTCCGAGGGCAGCACG
CTCACCACCGTGCTCTTCTTGGTCATCTGCAGCTTCATCGTCTTGGAGAACCTGATGGTT
TTGATTGCCATCTGGAAAAACAATAAATTTCACAACCGCATGTACTTTTTCATTGGCAAC
CTGGCTCTCTGCGACCTGCTGGCCGGCATCGCTTACAAGGTCAACATTCTGATGTCTGGC
AAGAAGACGTTCAGCCTGTCTCCCACGGTCTGGTTCCTCAGGGAGGGCAGTATGTTCGTG
GCCCTTGGGGCGTCCACCTGCAGCTTACTGGCCATCGCCATCGAGCGGCACTTGACAATG
ATCAAAATGAGGCCTTACGACGCCAACAAGAGGCACCGCGTCTTCCTCCTGATCGGGATG
TGCTGGCTCATTGCCTTCACGCTGGGCGCCCTGCCCATTCTGGGCTGGAACTGCCTGCAC
AATCTCCCTGACTGCTCTACCATCCTGCCCCTCTACTCCAAGAAGTACATTGCCTTCTGC
ATCAGCATCTTCACGGCCATCCTGGTGACCATCGTGATCCTCTACGCACGCATCTACTTC
CTGGTGAAGTCCAGCAGCCGTAAGGTGGCCAACCACAACAACTCGGAGCGGTCCATGGCA
CTGCTGCGGACCGTGGTGATTGTGGTGAGCGTGTTCATCGCCTGCTGGTCCCCACTCTTC
ATCCTCTTCCTCATTGATGTGGCCTGCAGGGTGCAGGCGTGCCCCATCCTCTTCAAGGCT
CAGTGGTTCATCGTGTTGGCTGTGCTCAACTCCGCCATGAACCCGGTCATCTACACGCTG
GCCAGCAAGGAGATGCGGCGGGCCTTCTTCCGTCTGGTCTGCAACTGCCTGGTCAGGGGA
CGGGGGGCCCGCGCCTCACCCATCCAGCCTGCGCTCGACCCAAGCAGAAGTAAATCAAGC
AGCAGCAACAATAGCAGCCACTCTCCGAAGGTCAAGGAAGACCTGCCCCACACAGCCCCC
TCATCCTGCATCATGGACAAGAACGCAGCACTTCAGAATGGGATCTTCTGCAACTGA
Chromosome Location
9
Locus
9q22.1
External Identifiers
ResourceLink
UniProtKB IDQ99500
UniProtKB Entry NameS1PR3_HUMAN
HGNC IDHGNC:3167
General References
  1. Yamaguchi F, Tokuda M, Hatase O, Brenner S: Molecular cloning of the novel human G protein-coupled receptor (GPCR) gene mapped on chromosome 9. Biochem Biophys Res Commun. 1996 Oct 14;227(2):608-14. [PubMed:8878560]
  2. An S, Bleu T, Huang W, Hallmark OG, Coughlin SR, Goetzl EJ: Identification of cDNAs encoding two G protein-coupled receptors for lysosphingolipids. FEBS Lett. 1997 Nov 17;417(3):279-82. [PubMed:9409733]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Ancellin N, Hla T: Differential pharmacological properties and signal transduction of the sphingosine 1-phosphate receptors EDG-1, EDG-3, and EDG-5. J Biol Chem. 1999 Jul 2;274(27):18997-9002. [PubMed:10383399]
  7. An S, Zheng Y, Bleu T: Sphingosine 1-phosphate-induced cell proliferation, survival, and related signaling events mediated by G protein-coupled receptors Edg3 and Edg5. J Biol Chem. 2000 Jan 7;275(1):288-96. [PubMed:10617617]
  8. Himmel HM, Meyer Zu Heringdorf D, Graf E, Dobrev D, Kortner A, Schuler S, Jakobs KH, Ravens U: Evidence for Edg-3 receptor-mediated activation of I(K.ACh) by sphingosine-1-phosphate in human atrial cardiomyocytes. Mol Pharmacol. 2000 Aug;58(2):449-54. [PubMed:10908314]
  9. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08868Fingolimodapproved, investigationalyesmodulatorDetails