50S ribosomal protein L3

Details

Name
50S ribosomal protein L3
Synonyms
Not Available
Gene Name
rplC
Organism
Streptococcus pyogenes serotype M1
Amino acid sequence
>lcl|BSEQ0010594|50S ribosomal protein L3
MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDGYEAVQVGFDDKREVL
SNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGDVVDVTGISKGKGFQGV
IKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMGGNRVTVQNLEIVQVIPE
KNVILVKGNVPGAKKSLITIKSAVKAAK
Number of residues
208
Molecular Weight
22438.035
Theoretical pI
10.88
GO Classification
Functions
rRNA binding / structural constituent of ribosome
Processes
translation
Components
ribosome
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010595|50S ribosomal protein L3 (rplC)
ATGACAAAAGGAATCTTAGGGAAAAAAGTGGGAATGACTCAAATTTTCACTGAATCAGGC
GAATTCATCCCTGTTACTGTCATTGAAGCAACTCCAAACGTTGTGCTTCAAGTTAAAACT
GTTGAAACAGACGGTTATGAAGCAGTTCAGGTTGGTTTTGATGACAAACGTGAAGTCTTG
AGTAACAAACCTGCCAAAGGCCATGTTGCAAAAGCAAACACAGCTCCTAAGCGCTTCATT
CGTGAATTCAAAAACATTGAAGGCTTAGAAGTTGGTGCAGAATTATCTGTAGAACAATTT
GAAGCTGGTGATGTTGTTGACGTCACAGGGATATCAAAAGGTAAAGGTTTCCAAGGTGTT
ATCAAACGCCATGGTCAATCACGTGGTCCTATGGCTCACGGTTCTCGTTACCATCGTCGC
CCAGGTTCTATGGGACCTGTTGCGCCTAACCGCGTTTTCAAAAACAAACGCTTGGCAGGA
CGTATGGGTGGTAACCGTGTAACAGTTCAAAACCTTGAAATTGTACAAGTTATCCCAGAA
AAGAACGTTATCCTTGTTAAAGGTAACGTACCAGGTGCTAAGAAATCTCTTATCACTATC
AAGTCAGCAGTTAAAGCTGCTAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9A1X4
UniProtKB Entry NameRL3_STRP1
GenBank Protein ID13621367
GenBank Gene IDAE006477
General References
  1. Ferretti JJ, McShan WM, Ajdic D, Savic DJ, Savic G, Lyon K, Primeaux C, Sezate S, Suvorov AN, Kenton S, Lai HS, Lin SP, Qian Y, Jia HG, Najar FZ, Ren Q, Zhu H, Song L, White J, Yuan X, Clifton SW, Roe BA, McLaughlin R: Complete genome sequence of an M1 strain of Streptococcus pyogenes. Proc Natl Acad Sci U S A. 2001 Apr 10;98(8):4658-63. [PubMed:11296296]
  2. Sumby P, Porcella SF, Madrigal AG, Barbian KD, Virtaneva K, Ricklefs SM, Sturdevant DE, Graham MR, Vuopio-Varkila J, Hoe NP, Musser JM: Evolutionary origin and emergence of a highly successful clone of serotype M1 group a Streptococcus involved multiple horizontal gene transfer events. J Infect Dis. 2005 Sep 1;192(5):771-82. Epub 2005 Jul 29. [PubMed:16088826]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01256RetapamulinapprovedyesinhibitorDetails
DB06145SpiramycinapprovedyesantagonistinhibitorDetails