HTH-type transcriptional regulator TtgR

Details

Name
HTH-type transcriptional regulator TtgR
Synonyms
  • Toluene efflux pump ttgABC operon repressor
Gene Name
ttgR
Organism
Pseudomonas putida (strain DOT-T1E)
Amino acid sequence
>lcl|BSEQ0012850|HTH-type transcriptional regulator TtgR
MVRRTKEEAQETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQSAVLDCHKGITLALANAVRRGQLPGELDAERAAVAMFAYVDGLIRRWLL
LPDSVDLLGDVEKWVDTGLDMLRLSPALRK
Number of residues
210
Molecular Weight
23854.075
Theoretical pI
6.17
GO Classification
Functions
DNA binding
Processes
regulation of transcription, DNA-templated / transcription, DNA-templated
General Function
Dna binding
Specific Function
Represses expression from the ttgABC operon promoter and its own expression. Binds to a promoter region between the divergently transcribed ttgR and ttgABC genes/operons; in the presence of chloramphenicol or tetracycline this binding no longer occurs and ttgR and ttgABC are derepressed. This suggests that TtgR binds these antibiotics.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0012851|HTH-type transcriptional regulator TtgR (ttgR)
ATGGTCCGTCGAACCAAAGAAGAAGCCCAGGAAACCCGTGCCCAGATCATCGAGGCGGCG
GAAAGGGCCTTCTACAAGCGCGGGGTTGCGCGAACCACCCTGGCCGACATCGCCGAACTG
GCGGGTGTGACGCGGGGGGCGATCTACTGGCACTTCAACAACAAGGCCGAGCTGGTGCAG
GCGTTGCTCGACAGCCTGCACGAGACCCATGACCATTTGGCGCGGGCGAGCGAAAGCGAG
GATGAAGTCGACCCGCTTGGCTGCATGCGCAAGCTGCTGTTGCAAGTGTTCAACGAGCTG
GTGCTCGATGCCCGAACCCGTCGTATCAATGAAATCCTGCATCACAAGTGCGAGTTCACC
GATGACATGTGTGAAATTCGCCAGCAGCGCCAGAGTGCGGTGCTGGATTGCCACAAGGGC
ATCACCCTGGCGCTGGCCAATGCCGTACGCCGGGGCCAGTTGCCTGGCGAGCTGGATGCC
GAGCGCGCGGCGGTGGCCATGTTTGCCTATGTCGATGGCCTGATCAGGCGCTGGCTATTG
CTGCCTGACAGTGTCGATCTGTTGGGTGATGTCGAAAAATGGGTCGACACCGGGCTGGAT
ATGCTGCGCTTGAGCCCGGCTCTGCGCAAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9AIU0
UniProtKB Entry NameTTGR_PSEPT
GenBank Protein ID13183097
GenBank Gene IDAF238479
General References
  1. Duque E, Segura A, Mosqueda G, Ramos JL: Global and cognate regulators control the expression of the organic solvent efflux pumps TtgABC and TtgDEF of Pseudomonas putida. Mol Microbiol. 2001 Feb;39(4):1100-6. [PubMed:11251828]
  2. Udaondo Z, Molina L, Daniels C, Gomez MJ, Molina-Henares MA, Matilla MA, Roca A, Fernandez M, Duque E, Segura A, Ramos JL: Metabolic potential of the organic-solvent tolerant Pseudomonas putida DOT-T1E deduced from its annotated genome. Microb Biotechnol. 2013 Sep;6(5):598-611. doi: 10.1111/1751-7915.12061. Epub 2013 Jul 1. [PubMed:23815283]
  3. Teran W, Felipe A, Segura A, Rojas A, Ramos JL, Gallegos MT: Antibiotic-dependent induction of Pseudomonas putida DOT-T1E TtgABC efflux pump is mediated by the drug binding repressor TtgR. Antimicrob Agents Chemother. 2003 Oct;47(10):3067-72. [PubMed:14506010]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB078103-(4-HYDROXYPHENYL)-1-(2,4,6-TRIHYDROXYPHENYL)PROPAN-1-ONEexperimentalunknownDetails
DB03467NaringeninexperimentalunknownDetails
DB04216Quercetinexperimental, investigationalunknownDetails