Interphotoreceptor matrix proteoglycan 2

Details

Name
Interphotoreceptor matrix proteoglycan 2
Synonyms
  • Interphotoreceptor matrix proteoglycan of 200 kDa
  • IPM 200
  • IPM200
  • Sialoprotein associated with cones and rods proteoglycan
  • Spacrcan
Gene Name
IMPG2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017566|Interphotoreceptor matrix proteoglycan 2
MIMFPLFGKISLGILIFVLIEGDFPSLTAQTYLSIEEIQEPKSAVSFLLPEESTDLSLAT
KKKQPLDRRETERQWLIRRRRSILFPNGVKICPDESVAEAVANHVKYFKVRVCQEAVWEA
FRTFWDRLPGREEYHYWMNLCEDGVTSIFEMGTNFSESVEHRSLIMKKLTYAKETVSSSE
LSSPVPVGDTSTLGDTTLSVPHPEVDAYEGASESSLERPEESISNEIENVIEEATKPAGE
QIAEFSIHLLGKQYREELQDSSSFHHQHLEEEFISEVENAFTGLPGYKEIRVLEFRSPKE
NDSGVDVYYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTVVYTISNFRDYIAE
TLQQNFLLGNSSLNPDPDSLQLINVRGVLRHQTEDLVWNTQSSSLQATPSSILDNTFQAA
WPSADESITSSIPPLDFSSGPPSATGRELWSESPLGDLVSTHKLAFPSKMGLSSSPEVLE
VSSLTLHSVTPAVLQTGLPVASEERTSGSHLVEDGLANVEESEDFLSIDSLPSSSFTQPV
PKETIPSMEDSDVSLTSSPYLTSSIPFGLDSLTSKVKDQLKVSPFLPDASMEKELIFDGG
LGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQ
ISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
PLILTSVAISASTDKSDQADAILREDMEQITESSNYEWFDSEVSMVKPDMQTLWTILPES
ERVWTRTSSLEKLSRDILASTPQSADRLWLSVTQSTKLPPTTISTLLEDEVIMGVQDISL
ELDRIGTDYYQPEQVQEQNGKVGSYVEMSTSVHSTEMVSVAWPTEGGDDLSYTQTSGALV
VFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNGSIV
VNSRMKFANSVPPNVNNAVYMILEDFCTTAYNTMNLAIDKYSLDVESGDEANPCKFQACN
EFSECLVNPWSGEAKCRCFPGYLSVEERPCQSLCDLQPDFCLNDGKCDIMPGHGAICRCR
VGENWWYRGKHCEEFVSEPVIIGITIASVVGLLVIFSAIIYFFIRTLQAHHDRSERESPF
SGSSRQPDSLSSIENAVKYNPVYESHRAGCEKYEGPYPQHPFYSSASGDVIGGLSREEIR
QMYESSELSREEIQERMRVLELYANDPEFAAFVREQQVEEV
Number of residues
1241
Molecular Weight
138619.39
Theoretical pI
Not Available
GO Classification
Functions
extracellular matrix structural constituent / heparin binding / hyaluronic acid binding
Processes
visual perception
Components
integral component of membrane / proteinaceous extracellular matrix / receptor complex
General Function
Hyaluronic acid binding
Specific Function
Chondroitin sulfate- and hyaluronan-binding proteoglycan involved in the organization of interphotoreceptor matrix; may participate in the maturation and maintenance of the light-sensitive photoreceptor outer segment. Binds heparin.
Pfam Domain Function
Transmembrane Regions
1100-1120
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0017567|Interphotoreceptor matrix proteoglycan 2 (IMPG2)
ATGATTATGTTTCCTCTTTTTGGGAAGATTTCTCTGGGTATTTTGATATTTGTCCTGATA
GAAGGAGACTTTCCATCATTAACAGCACAAACCTACTTATCTATAGAGGAGATCCAAGAA
CCCAAGAGTGCAGTTTCTTTTCTCCTGCCTGAAGAATCAACAGACCTTTCTCTAGCTACC
AAAAAGAAACAGCCTCTGGACCGCAGAGAAACTGAAAGACAGTGGTTAATCAGAAGGCGG
AGATCTATTCTGTTTCCTAATGGAGTGAAAATCTGCCCAGATGAAAGTGTTGCAGAGGCT
GTGGCAAATCATGTGAAGTATTTTAAAGTCCGAGTGTGTCAGGAAGCTGTCTGGGAAGCC
TTCAGGACTTTTTGGGATCGACTTCCTGGGCGTGAGGAATATCATTACTGGATGAATTTG
TGTGAGGATGGAGTCACAAGTATATTTGAAATGGGCACAAATTTTAGTGAATCTGTGGAA
CATAGAAGCTTAATCATGAAGAAACTGACTTATGCAAAGGAAACTGTAAGCAGCTCTGAA
CTGTCTTCTCCAGTTCCTGTTGGTGATACTTCAACATTGGGAGACACTACTCTCAGTGTT
CCACATCCAGAGGTGGACGCCTATGAAGGTGCCTCAGAGAGCAGCTTGGAAAGGCCAGAG
GAGAGTATTAGCAATGAAATTGAGAATGTGATAGAAGAAGCCACAAAACCAGCAGGTGAA
CAGATTGCAGAATTCAGTATCCACCTTTTGGGGAAGCAGTACAGGGAAGAACTACAGGAT
TCCTCCAGCTTTCACCACCAGCACCTTGAAGAAGAATTTATTTCAGAGGTTGAAAATGCA
TTTACTGGGTTACCAGGCTACAAGGAAATTCGTGTACTTGAATTTAGGTCCCCCAAGGAA
AATGACAGTGGCGTAGATGTTTACTATGCAGTTACCTTCAATGGTGAGGCCATCAGCAAT
ACCACCTGGGACCTCATTAGCCTTCACTCCAACAAGGTGGAAAACCATGGCCTTGTGGAA
CTGGATGATAAACCCACTGTTGTTTATACAATCAGTAACTTCAGAGATTATATTGCTGAG
ACATTGCAGCAGAATTTTTTGCTGGGGAACTCTTCCTTGAATCCAGATCCTGATTCCCTG
CAGCTTATCAATGTGAGAGGAGTTTTGCGTCACCAAACTGAAGATCTAGTTTGGAACACC
CAAAGTTCAAGTCTTCAGGCAACGCCGTCATCTATTCTGGATAATACCTTTCAAGCTGCA
TGGCCCTCAGCAGATGAATCCATCACCAGCAGTATTCCACCACTTGATTTCAGCTCTGGT
CCTCCCTCAGCCACTGGCAGGGAACTCTGGTCAGAAAGTCCTTTGGGTGATTTAGTGTCT
ACACACAAATTAGCCTTTCCCTCGAAGATGGGCCTCAGCTCTTCCCCAGAGGTTTTAGAG
GTTAGCAGCTTGACTCTTCATTCTGTCACCCCGGCAGTGCTTCAGACTGGCTTGCCTGTG
GCTTCTGAGGAAAGGACTTCTGGATCTCACTTGGTAGAAGATGGATTAGCCAATGTTGAA
GAGTCAGAAGATTTTCTTTCTATTGATTCATTGCCTTCAAGTTCATTCACTCAACCTGTG
CCAAAAGAAACAATACCATCCATGGAAGACTCTGATGTGTCCTTAACATCTTCACCATAT
CTGACCTCTTCTATACCTTTTGGCTTGGACTCCTTGACCTCCAAAGTCAAAGACCAATTA
AAAGTGAGCCCTTTCCTGCCAGATGCATCCATGGAAAAAGAGTTAATATTTGACGGTGGT
TTAGGTTCAGGGTCTGGGCAAAAGGTAGATCTGATTACTTGGCCATGGAGTGAGACTTCA
TCAGAGAAGAGCGCTGAACCACTGTCCAAGCCGTGGCTTGAAGATGATGATTCACTTTTG
CCAGCTGAGATTGAAGACAAGAAACTAGTTTTAGTTGACAAAATGGATTCCACAGACCAA
ATTAGTAAGCACTCAAAATATGAACATGATGACAGATCCACACACTTTCCAGAGGAAGAG
CCTCTTAGTGGGCCTGCTGTGCCCATCTTCGCAGATACTGCAGCTGAATCTGCGTCTCTA
ACCCTCCCCAAGCACATATCAGAAGTACCTGGTGTTGATGATTACTCAGTTACCAAAGCA
CCTCTTATACTGACATCTGTAGCAATCTCTGCCTCTACTGATAAATCAGATCAGGCAGAT
GCCATCCTAAGGGAGGATATGGAACAAATTACTGAGTCATCCAACTATGAATGGTTTGAC
AGTGAGGTTTCAATGGTAAAGCCAGATATGCAAACTTTGTGGACTATATTGCCAGAATCA
GAGAGAGTTTGGACAAGAACTTCTTCCCTAGAGAAATTGTCCAGAGACATATTGGCAAGT
ACACCACAGAGTGCTGACAGGCTCTGGTTATCTGTGACACAGTCTACCAAATTGCCTCCA
ACCACAATCTCCACCCTGCTAGAGGATGAAGTAATTATGGGTGTACAGGATATTTCGTTA
GAACTGGACCGGATAGGCACAGATTACTATCAGCCTGAGCAAGTCCAAGAGCAAAATGGC
AAGGTTGGTAGTTATGTGGAAATGTCAACAAGTGTTCACTCCACAGAGATGGTTAGTGTG
GCTTGGCCCACAGAAGGAGGAGATGACTTGAGTTATACCCAGACTTCAGGAGCTTTGGTG
GTTTTCTTCAGCCTCCGAGTGACTAACATGATGTTTTCAGAAGATCTGTTTAATAAAAAC
TCCTTGGAGTATAAAGCCCTGGAGCAAAGATTCTTAGAATTGCTGGTTCCCTATCTCCAG
TCAAATCTCACGGGGTTCCAGAACTTAGAAATCCTCAACTTCAGAAATGGCAGCATTGTG
GTGAACAGTCGAATGAAGTTTGCCAATTCTGTCCCTCCTAACGTCAACAATGCGGTGTAC
ATGATTCTGGAAGACTTTTGTACCACTGCCTACAATACCATGAACTTGGCTATTGATAAA
TACTCTCTTGATGTGGAATCAGGTGATGAAGCCAACCCTTGCAAGTTTCAGGCCTGTAAT
GAATTTTCAGAGTGTCTGGTCAACCCCTGGAGTGGAGAAGCAAAGTGCAGATGCTTCCCT
GGATACCTGAGTGTGGAAGAACGGCCCTGTCAGAGTCTCTGTGACCTACAGCCTGACTTC
TGCTTGAATGATGGAAAGTGTGACATTATGCCTGGGCACGGGGCCATTTGTAGGTGCCGG
GTGGGTGAGAACTGGTGGTACCGAGGCAAGCACTGTGAGGAATTTGTGTCTGAGCCCGTG
ATCATAGGCATCACTATTGCCTCCGTGGTTGGACTTCTTGTCATCTTTTCTGCTATCATC
TACTTCTTCATCAGGACTCTCCAAGCACACCATGACAGGAGTGAAAGAGAGAGTCCCTTC
AGTGGCTCCAGCAGGCAGCCTGACAGCCTCTCATCTATTGAGAATGCTGTGAAGTACAAC
CCCGTGTATGAAAGTCACAGGGCTGGATGTGAGAAGTATGAGGGACCCTATCCTCAGCAT
CCCTTCTACAGCTCTGCTAGCGGAGACGTGATTGGTGGGCTGAGCAGAGAAGAAATCAGA
CAGATGTATGAGAGCAGTGAGCTTTCCAGAGAGGAAATTCAAGAGAGAATGAGAGTTTTG
GAACTGTATGCCAATGATCCTGAGTTTGCAGCTTTTGTGAGAGAGCAACAAGTGGAAGAG
GTTTAA
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9BZV3
UniProtKB Entry NameIMPG2_HUMAN
HGNC IDHGNC:18362
General References
  1. Kuehn MH, Hageman GS: Molecular characterization and genomic mapping of human IPM 200, a second member of a novel family of proteoglycans. Mol Cell Biol Res Commun. 1999 Aug;2(2):103-10. [PubMed:10542133]
  2. Acharya S, Foletta VC, Lee JW, Rayborn ME, Rodriguez IR, Young WS 3rd, Hollyfield JG: SPACRCAN, a novel human interphotoreceptor matrix hyaluronan-binding proteoglycan synthesized by photoreceptors and pinealocytes. J Biol Chem. 2000 Mar 10;275(10):6945-55. [PubMed:10702256]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  4. Kuehn MH, Stone EM, Hageman GS: Organization of the human IMPG2 gene and its evaluation as a candidate gene in age-related macular degeneration and other retinal degenerative disorders. Invest Ophthalmol Vis Sci. 2001 Dec;42(13):3123-9. [PubMed:11726612]
  5. Bandah-Rozenfeld D, Collin RW, Banin E, van den Born LI, Coene KL, Siemiatkowska AM, Zelinger L, Khan MI, Lefeber DJ, Erdinest I, Testa F, Simonelli F, Voesenek K, Blokland EA, Strom TM, Klaver CC, Qamar R, Banfi S, Cremers FP, Sharon D, den Hollander AI: Mutations in IMPG2, encoding interphotoreceptor matrix proteoglycan 2, cause autosomal-recessive retinitis pigmentosa. Am J Hum Genet. 2010 Aug 13;87(2):199-208. doi: 10.1016/j.ajhg.2010.07.004. Epub 2010 Jul 30. [PubMed:20673862]
  6. Meunier I, Manes G, Bocquet B, Marquette V, Baudoin C, Puech B, Defoort-Dhellemmes S, Audo I, Verdet R, Arndt C, Zanlonghi X, Le Meur G, Dhaenens CM, Hamel CP: Frequency and clinical pattern of vitelliform macular dystrophy caused by mutations of interphotoreceptor matrix IMPG1 and IMPG2 genes. Ophthalmology. 2014 Dec;121(12):2406-14. doi: 10.1016/j.ophtha.2014.06.028. Epub 2014 Jul 29. [PubMed:25085631]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails