Matrix metalloproteinase-27

Details

Name
Matrix metalloproteinase-27
Synonyms
  • 3.4.24.-
  • MMP-27
Gene Name
MMP27
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017190|Matrix metalloproteinase-27
MKRLLLLFLFFITFSSAFPLVRMTENEENMQLAQAYLNQFYSLEIEGNHLVQSKNRSLID
DKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTP
DMARAAVDEAIQEGLEVWSKVTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLG
HAFPPGPGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS
LDPRKYPLSQDDINGIQSIYGGLPKEPAKPKEPTIPHACDPDLTFDAITTFRREVMFFKG
RHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDY
PKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHFPG
ISIRVDAAFQYKGFFFFSRGSKQFEYDIKTKNITRIMRTNTWFQCKEPKNSSFGFDINKE
KAHSGGIKILYHKSLSLFIFGIVHLLKNTSIYQ
Number of residues
513
Molecular Weight
59025.39
Theoretical pI
8.95
GO Classification
Functions
calcium ion binding / metalloendopeptidase activity / zinc ion binding
Processes
collagen catabolic process
Components
extracellular matrix / extrinsic component of endoplasmic reticulum membrane
General Function
Zinc ion binding
Specific Function
Matrix metalloproteinases degrade protein components of the extracellular matrix such as fibronectin, laminin, gelatins and/or collagens.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0017191|Matrix metalloproteinase-27 (MMP27)
ATGAAGCGCCTTCTGCTTCTGTTTTTGTTCTTTATAACATTTTCTTCTGCATTTCCCTTA
GTCCGGATGACGGAAAATGAAGAAAATATGCAACTGGCTCAGGCATATCTCAACCAGTTC
TACTCTCTTGAAATAGAAGGGAATCATCTTGTTCAAAGCAAGAATAGGAGTCTCATAGAT
GACAAAATTCGGGAAATGCAAGCATTTTTTGGATTGACAGTGACTGGAAAACTGGACTCA
AACACCCTTGAGATCATGAAGACACCCAGGTGTGGGGTGCCTGATGTGGGCCAGTATGGC
TACACCCTCCCTGGGTGGAGAAAATACAACCTCACCTACAGAATAATAAACTATACTCCG
GATATGGCACGAGCTGCTGTGGATGAGGCTATCCAAGAAGGTTTAGAAGTGTGGAGCAAA
GTCACTCCACTAAAATTCACCAAGATTTCAAAGGGGATTGCAGACATCATGATTGCCTTT
AGGACTCGAGTCCATGGTCGGTGTCCTCGCTATTTTGATGGTCCCTTGGGAGTGCTTGGC
CATGCCTTTCCTCCTGGTCCGGGTCTGGGTGGTGACACTCATTTTGATGAGGATGAAAAC
TGGACCAAGGATGGAGCAGGATTCAACTTGTTTCTTGTGGCTGCTCATGAATTTGGTCAT
GCACTGGGGCTCTCTCACTCCAATGATCAAACAGCCTTGATGTTCCCAAATTATGTCTCC
CTGGATCCCAGAAAATACCCACTTTCTCAGGATGATATCAATGGAATCCAGTCCATCTAT
GGAGGTCTGCCTAAGGAACCTGCTAAGCCAAAGGAACCCACTATACCCCATGCCTGTGAC
CCTGACTTGACTTTTGACGCTATCACAACTTTCCGCAGAGAAGTAATGTTCTTTAAAGGC
AGGCACCTATGGAGGATCTATTATGATATCACGGATGTTGAGTTTGAATTAATTGCTTCA
TTCTGGCCATCTCTGCCAGCTGATCTGCAAGCTGCATACGAGAACCCCAGAGATAAGATT
CTGGTTTTTAAAGATGAAAACTTCTGGATGATCAGAGGATATGCTGTCTTGCCAGATTAT
CCCAAATCCATCCATACATTAGGTTTTCCAGGACGTGTGAAGAAAATAGATGCAGCCGTC
TGTGATAAGACCACAAGAAAAACCTACTTCTTTGTGGGCATTTGGTGCTGGAGGTTTGAT
GAAATGACCCAAACCATGGACAAAGGGTTCCCGCAGAGAGTGGTAAAACACTTTCCTGGA
ATCAGTATCCGTGTTGATGCTGCTTTCCAGTACAAAGGATTCTTCTTTTTCAGCCGTGGA
TCAAAGCAATTTGAATACGACATTAAGACAAAGAATATTACCCGAATCATGAGAACTAAT
ACTTGGTTTCAATGCAAAGAACCAAAGAACTCCTCATTTGGTTTTGATATCAACAAGGAA
AAAGCACATTCAGGAGGCATAAAGATATTGTATCATAAGAGTTTAAGCTTGTTTATTTTT
GGTATTGTTCATTTGCTGAAAAACACTTCTATTTATCAATAA
Chromosome Location
11
Locus
11q24
External Identifiers
ResourceLink
UniProtKB IDQ9H306
UniProtKB Entry NameMMP27_HUMAN
GenBank Protein ID11066090
GenBank Gene IDAF195192
HGNC IDHGNC:14250
General References
  1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  3. Bar-Or A, Nuttall RK, Duddy M, Alter A, Kim HJ, Ifergan I, Pennington CJ, Bourgoin P, Edwards DR, Yong VW: Analyses of all matrix metalloproteinase members in leukocytes emphasize monocytes as major inflammatory mediators in multiple sclerosis. Brain. 2003 Dec;126(Pt 12):2738-49. Epub 2003 Sep 23. [PubMed:14506071]
  4. Cominelli A, Gaide Chevronnay HP, Lemoine P, Courtoy PJ, Marbaix E, Henriet P: Matrix metalloproteinase-27 is expressed in CD163+/CD206+ M2 macrophages in the cycling human endometrium and in superficial endometriotic lesions. Mol Hum Reprod. 2014 Aug;20(8):767-75. doi: 10.1093/molehr/gau034. Epub 2014 May 8. [PubMed:24810263]
  5. Cominelli A, Halbout M, N'Kuli F, Lemoine P, Courtoy PJ, Marbaix E, Tyteca D, Henriet P: A unique C-terminal domain allows retention of matrix metalloproteinase-27 in the endoplasmic reticulum. Traffic. 2014 Apr;15(4):401-17. doi: 10.1111/tra.12149. Epub 2014 Feb 6. [PubMed:24548619]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00786MarimastatinvestigationalyesinhibitorDetails