Histamine H4 receptor

Details

Name
Histamine H4 receptor
Synonyms
  • AXOR35
  • G-protein coupled receptor 105
  • GPCR105
  • GPRv53
  • H4R
  • Pfi-013
  • SP9144
Gene Name
HRH4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000291|Histamine H4 receptor
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Number of residues
390
Molecular Weight
44495.375
Theoretical pI
9.92
GO Classification
Functions
histamine binding / histamine receptor activity
Processes
inflammatory response / negative regulation of adenylate cyclase activity / positive regulation of cytosolic calcium ion concentration / regulation of MAPK cascade / sensory perception of chemical stimulus
Components
cytosol / integral component of plasma membrane / plasma membrane
General Function
Histamine receptor activity
Specific Function
The H4 subclass of histamine receptors could mediate the histamine signals in peripheral tissues. Displays a significant level of constitutive activity (spontaneous activity in the absence of agonist).
Pfam Domain Function
Transmembrane Regions
20-40 53-73 88-108 132-152 173-193 305-325 342-362
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0009967|Histamine H4 receptor (HRH4)
ATGCCAGATACTAATAGCACAATCAATTTATCACTAAGCACTCGTGTTACTTTAGCATTT
TTTATGTCCTTAGTAGCTTTTGCTATAATGCTAGGAAATGCTTTGGTCATTTTAGCTTTT
GTGGTGGACAAAAACCTTAGACATCGAAGTAGTTATTTTTTTCTTAACTTGGCCATCTCT
GACTTCTTTGTGGTTTCAGAGTCTTGGAAGGATGAAGGTAGTGAATGTGAACCTGGATTT
TTTTCGGAATGGTACATCCTTGCCATCACATCATTCTTGGAATTCGTGATCCCAGTCATC
TTAGTCGCTTATTTCAACATGAATATTTATTGGAGCCTGTGGAAGCGTGATCATCTCAGT
AGGTGCCAAAGCCATCCTGGACTGACTGCTGTCTCTTCCAACATCTGTGGACACTCATTC
AGAGGTAGACTATCTTCAAGGAGATCTCTTTCTGCATCGACAGAAGTTCCTGCATCCTTT
CATTCAGAGAGACAGAGGAGAAAGAGTAGTCTCATGTTTTCCTCAAGAACCAAGATGAAT
AGCAATACAATTGCTTCCAAAATGGGTTCCTTCTCCCAATCAGATTCTGTAGCTCTTCAC
CAAAGGGAACATGTTGAACTGCTTAGAGCCAGGAGATTAGCCAAGTCACTGGCCATTCTC
TTAGGGGTTTTTGCTGTTTGCTGGGCTCCATATTCTCTGTTCACAATTGTCCTTTCATTT
TATTCCTCAGCAACAGGTCCTAAATCAGTTTGGTATAGAATTGCATTTTGGCTTCAGTGG
TTCAATTCCTTTGTCAATCCTCTTTTGTATCCATTGTGTCACAAGCGCTTTCAAAAGGCT
TTCTTGAAAATATTTTGTATAAAAAAGCAACCTCTACCATCACAACACAGTCGGTCAGTA
TCTTCTTAA
Chromosome Location
18
Locus
18q11.2
External Identifiers
ResourceLink
UniProtKB IDQ9H3N8
UniProtKB Entry NameHRH4_HUMAN
GenBank Protein ID10241847
GenBank Gene IDAB044934
GenAtlas IDHRH4
HGNC IDHGNC:17383
General References
  1. Oda T, Morikawa N, Saito Y, Masuho Y, Matsumoto S: Molecular cloning and characterization of a novel type of histamine receptor preferentially expressed in leukocytes. J Biol Chem. 2000 Nov 24;275(47):36781-6. [PubMed:10973974]
  2. Nakamura T, Itadani H, Hidaka Y, Ohta M, Tanaka K: Molecular cloning and characterization of a new human histamine receptor, HH4R. Biochem Biophys Res Commun. 2000 Dec 20;279(2):615-20. [PubMed:11118334]
  3. Liu C, Ma X, Jiang X, Wilson SJ, Hofstra CL, Blevitt J, Pyati J, Li X, Chai W, Carruthers N, Lovenberg TW: Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol. 2001 Mar;59(3):420-6. [PubMed:11179434]
  4. Morse KL, Behan J, Laz TM, West RE Jr, Greenfeder SA, Anthes JC, Umland S, Wan Y, Hipkin RW, Gonsiorek W, Shin N, Gustafson EL, Qiao X, Wang S, Hedrick JA, Greene J, Bayne M, Monsma FJ Jr: Cloning and characterization of a novel human histamine receptor. J Pharmacol Exp Ther. 2001 Mar;296(3):1058-66. [PubMed:11181941]
  5. Zhu Y, Michalovich D, Wu H, Tan KB, Dytko GM, Mannan IJ, Boyce R, Alston J, Tierney LA, Li X, Herrity NC, Vawter L, Sarau HM, Ames RS, Davenport CM, Hieble JP, Wilson S, Bergsma DJ, Fitzgerald LR: Cloning, expression, and pharmacological characterization of a novel human histamine receptor. Mol Pharmacol. 2001 Mar;59(3):434-41. [PubMed:11179436]
  6. O'Reilly M, Alpert R, Jenkinson S, Gladue RP, Foo S, Trim S, Peter B, Trevethick M, Fidock M: Identification of a histamine H4 receptor on human eosinophils--role in eosinophil chemotaxis. J Recept Signal Transduct Res. 2002 Feb-Nov;22(1-4):431-48. [PubMed:12503632]
  7. van Rijn RM, van Marle A, Chazot PL, Langemeijer E, Qin Y, Shenton FC, Lim HD, Zuiderveld OP, Sansuk K, Dy M, Smit MJ, Tensen CP, Bakker RA, Leurs R: Cloning and characterization of dominant negative splice variants of the human histamine H4 receptor. Biochem J. 2008 Aug 15;414(1):121-31. doi: 10.1042/BJ20071583. [PubMed:18452403]
  8. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791]
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00363ClozapineapprovednoantagonistDetails
DB05032REV131investigationalunknownDetails
DB05381Histamineapproved, investigationalunknownagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownbinderDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00543AmoxapineapprovedunknownbinderDetails
DB01142Doxepinapproved, investigationalunknownbinderDetails
DB00321AmitriptylineapprovedunknownbinderDetails
DB06148Mianserinapproved, investigationalunknownbinderDetails
DB01620Pheniramineapprovedyesinverse agonistDetails
DB01238Aripiprazoleapproved, investigationalunknownligandDetails