Solute carrier family 28 member 3

Details

Name
Solute carrier family 28 member 3
Synonyms
  • CNT 3
  • CNT3
  • Concentrative Na(+)-nucleoside cotransporter 3
  • hCNT3
Gene Name
SLC28A3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007057|Solute carrier family 28 member 3
MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVE
QDSPRNREHMEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISA
CVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHRIDEMLSPGRRLLNSHWFWLKWVIWSS
LVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVLLFLFSKYPTRVYWRPVLWGIGLQFLLG
LLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYKDHFFAFKVLPIVVFFSTVMS
MLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRPYLPYITKSEL
HAIMTAGFSTIAGSVLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKN
AMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQL
SFELICSYIFMPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKF
VNGVQQYISIRSEIIATYALCGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTV
ACFMTACIAGILSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVI
PGGNHSLYSLKGCCTLLNPSTFNCNGISNTF
Number of residues
691
Molecular Weight
76929.61
Theoretical pI
7.67
GO Classification
Functions
purine-specific nucleoside / pyrimidine- and adenine-specific
Processes
purine nucleobase transport / purine nucleoside transmembrane transport / pyrimidine nucleobase transport / pyrimidine nucleoside transport / pyrimidine-containing compound transmembrane transport / retina homeostasis / sodium ion transmembrane transport / transmembrane transport
Components
endoplasmic reticulum membrane / integral component of plasma membrane / plasma membrane
General Function
Pyrimidine- and adenine-specific:sodium symporter activity
Specific Function
Sodium-dependent, pyrimidine- and purine-selective. Involved in the homeostasis of endogenous nucleosides. Exhibits the transport characteristics of the nucleoside transport system cib or N3 subtype (N3/cib) (with marked transport of both thymidine and inosine). Employs a 2:1 sodium/nucleoside ratio. Also able to transport gemcitabine, 3'-azido-3'-deoxythymidine (AZT), ribavirin and 3-deazauridine.
Pfam Domain Function
Transmembrane Regions
103-123 128-148 171-191 201-221 224-244 288-308 315-335 362-382 389-409 444-464 480-500 554-574 594-614
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020702|Solute carrier family 28 member 3 (SLC28A3)
ATGGAGCTGAGGAGTACAGCAGCCCCCAGAGCTGAGGGCTACAGCAACGTGGGCTTCCAG
AATGAAGAAAACTTTCTTGAGAACGAGAACACATCAGGAAACAACTCAATAAGAAGCAGA
GCTGTGCAAAGCAGGGAGCACACAAACACCAAACAGGATGAAGAACAGGTCACAGTTGAG
CAGGATTCTCCAAGAAACAGAGAACACATGGAGGATGATGATGAGGAGATGCAACAAAAA
GGGTGTTTGGAAAGGAGGTATGACACAGTATGTGGTTTCTGTAGGAAACACAAAACAACT
CTTCGGCACATCATCTGGGGCATTTTATTAGCAGGTTATCTGGTTATGGTGATTTCGGCC
TGTGTGCTGAACTTTCACAGAGCCCTTCCTCTTTTTGTGATCACCGTGGCTGCCATCTTC
TTTGTTGTCTGGGATCACCTGATGGCCAAATACGAACATCGAATTGATGAGATGCTGTCT
CCTGGCAGAAGGCTTCTAAACAGCCATTGGTTCTGGCTGAAGTGGGTGATCTGGAGCTCC
CTGGTCCTAGCAGTTATTTTCTGGTTGGCCTTTGACACTGCCAAATTGGGTCAACAGCAG
CTGGTGTCCTTCGGTGGGCTCATAATGTACATTGTCCTGTTATTTCTATTTTCCAAGTAC
CCAACCAGAGTTTACTGGAGACCTGTCTTATGGGGAATCGGGCTACAGTTTCTTCTTGGG
CTCTTGATTCTAAGGACTGACCCTGGATTTATAGCTTTTGATTGGTTGGGCAGACAAGTT
CAGACTTTTCTGGAGTACACAGATGCTGGTGCTTCATTTGTCTTTGGTGAGAAATACAAA
GACCACTTCTTTGCATTTAAGGTCCTGCCGATCGTGGTTTTCTTCAGCACTGTGATGTCC
ATGCTGTACTACCTGGGACTGATGCAGTGGATTATTAGAAAGGTTGGATGGATCATGCTA
GTTACTACGGGATCATCTCCTATTGAATCTGTAGTTGCTTCTGGCAATATATTTGTTGGA
CAAACGGAGTCTCCACTGCTGGTCCGACCATATTTACCTTACATCACCAAGTCTGAACTC
CACGCCATCATGACCGCCGGGTTCTCTACCATTGCTGGAAGCGTGCTAGGTGCATACATT
TCTTTTGGGGTTCCATCCTCCCACTTGTTAACAGCGTCAGTTATGTCAGCACCTGCGTCA
TTGGCTGCTGCTAAACTCTTTTGGCCTGAGACAGAAAAACCTAAAATAACCCTCAAGAAT
GCCATGAAAATGGAAAGTGGTGATTCAGGGAATCTTCTAGAAGCTGCAACACAGGGAGCA
TCCTCCTCCATCTCCCTGGTGGCCAACATCGCTGTGAATCTGATTGCCTTCCTGGCCCTG
CTGTCTTTTATGAATTCAGCCCTGTCCTGGTTTGGAAACATGTTTGACTACCCACAGCTG
AGTTTTGAGCTAATCTGCTCCTACATCTTCATGCCCTTTTCCTTCATGATGGGAGTGGAA
TGGCAGGACAGCTTTATGGTTGCCAGACTCATAGGTTATAAGACCTTCTTCAATGAATTT
GTGGCTTATGAGCACCTCTCAAAATGGATCCACTTGAGGAAAGAAGGTGGACCCAAATTT
GTAAACGGTGTGCAGCAATATATATCAATTCGTTCTGAGATAATCGCCACTTACGCTCTC
TGTGGTTTTGCCAATATCGGGTCCCTAGGAATCGTGATCGGCGGACTCACATCCATGGCT
CCTTCCAGAAAGCGTGATATCGCCTCGGGGGCAGTGAGAGCTCTGATTGCGGGGACCGTG
GCCTGCTTCATGACAGCCTGCATCGCAGGCATACTCTCCAGCACTCCTGTGGACATCAAC
TGCCATCACGTTTTAGAGAATGCCTTCAACTCCACTTTCCCTGGAAACACAACCAAGGTG
ATAGCTTGTTGCCAAAGTCTGTTGAGCAGCACTGTTGCCAAGGGTCCTGGTGAAGTCATC
CCAGGAGGAAACCACAGTCTGTATTCTTTGAAGGGCTGCTGCACATTGTTGAATCCATCG
ACCTTTAACTGCAATGGGATCTCTAATACATTTTGA
Chromosome Location
9
Locus
9q22.2
External Identifiers
ResourceLink
UniProtKB IDQ9HAS3
UniProtKB Entry NameS28A3_HUMAN
GenBank Protein ID10732815
GenBank Gene IDAF305210
HGNC IDHGNC:16484
General References
  1. Ritzel MW, Ng AM, Yao SY, Graham K, Loewen SK, Smith KM, Ritzel RG, Mowles DA, Carpenter P, Chen XZ, Karpinski E, Hyde RJ, Baldwin SA, Cass CE, Young JD: Molecular identification and characterization of novel human and mouse concentrative Na+-nucleoside cotransporter proteins (hCNT3 and mCNT3) broadly selective for purine and pyrimidine nucleosides (system cib). J Biol Chem. 2001 Jan 26;276(4):2914-27. Epub 2000 Oct 13. [PubMed:11032837]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Damaraju S, Zhang J, Visser F, Tackaberry T, Dufour J, Smith KM, Slugoski M, Ritzel MW, Baldwin SA, Young JD, Cass CE: Identification and functional characterization of variants in human concentrative nucleoside transporter 3, hCNT3 (SLC28A3), arising from single nucleotide polymorphisms in coding regions of the hCNT3 gene. Pharmacogenet Genomics. 2005 Mar;15(3):173-82. [PubMed:15861042]
  6. Hu H, Endres CJ, Chang C, Umapathy NS, Lee EW, Fei YJ, Itagaki S, Swaan PW, Ganapathy V, Unadkat JD: Electrophysiological characterization and modeling of the structure activity relationship of the human concentrative nucleoside transporter 3 (hCNT3). Mol Pharmacol. 2006 May;69(5):1542-53. Epub 2006 Jan 30. [PubMed:16446384]
  7. Yamamoto T, Kuniki K, Takekuma Y, Hirano T, Iseki K, Sugawara M: Ribavirin uptake by cultured human choriocarcinoma (BeWo) cells and Xenopus laevis oocytes expressing recombinant plasma membrane human nucleoside transporters. Eur J Pharmacol. 2007 Feb 14;557(1):1-8. Epub 2006 Nov 3. [PubMed:17140564]
  8. Errasti-Murugarren E, Molina-Arcas M, Casado FJ, Pastor-Anglada M: A splice variant of the SLC28A3 gene encodes a novel human concentrative nucleoside transporter-3 (hCNT3) protein localized in the endoplasmic reticulum. FASEB J. 2009 Jan;23(1):172-82. doi: 10.1096/fj.08-113902. Epub 2008 Sep 30. [PubMed:18827020]
  9. Badagnani I, Chan W, Castro RA, Brett CM, Huang CC, Stryke D, Kawamoto M, Johns SJ, Ferrin TE, Carlson EJ, Burchard EG, Giacomini KM: Functional analysis of genetic variants in the human concentrative nucleoside transporter 3 (CNT3; SLC28A3). Pharmacogenomics J. 2005;5(3):157-65. [PubMed:15738947]
  10. Errasti-Murugarren E, Cano-Soldado P, Pastor-Anglada M, Casado FJ: Functional characterization of a nucleoside-derived drug transporter variant (hCNT3C602R) showing altered sodium-binding capacity. Mol Pharmacol. 2008 Feb;73(2):379-86. Epub 2007 Nov 9. [PubMed:17993510]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00811RibavirinapprovedunknownsubstrateDetails
DB00640Adenosineapproved, investigationalunknownDetails
DB00242Cladribineapproved, investigationalunknownDetails
DB01073FludarabineapprovedunknownDetails
DB04335Inosineexperimental, investigationalunknownDetails
DB04485Thymidineexperimental, investigationalunknownDetails
DB00441GemcitabineapprovedunknownsubstrateDetails
DB01033MercaptopurineapprovedunknownsubstrateDetails
DB09327Tegafur-uracilapproved, investigationalnosubstrateDetails
DB00993AzathioprineapprovedunknownsubstrateDetails