Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A

Details

Name
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
Synonyms
  • 3.1.4.35
  • cAMP and cGMP phosphodiesterase 11A
Gene Name
PDE11A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037245|Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
Number of residues
933
Molecular Weight
104750.64
Theoretical pI
6.51
GO Classification
Functions
3',5'-cyclic-GMP phosphodiesterase activity / 3',5'-cyclic-nucleotide phosphodiesterase activity / cAMP binding / cGMP binding / cGMP-stimulated cyclic-nucleotide phosphodiesterase activity / cyclic-nucleotide phosphodiesterase activity / metal ion binding
Processes
blood coagulation / cAMP catabolic process / cGMP catabolic process / signal transduction
Components
cytosol / perikaryon
General Function
Metal ion binding
Specific Function
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides cAMP and cGMP. Catalyzes the hydrolysis of both cAMP and cGMP to 5'-AMP and 5'-GMP, respectively.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0012476|Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A (PDE11A)
ATGTCCCCAAAGTGCAGTGCTGATGCTGAGAACAGTTTCAAAGAAAGCATGGAGAAATCA
TCATACTCCGACTGGCTAATAAATAACAGCATTGCTGAGCTGGTTGCTTCAACAGGCCTT
CCAGTGAACATCAGTGATGCCTACCAGGATCCGCGCTTTGATGCAGAGGCAGACCAGATA
TCTGGTTTTCACATAAGATCTGTTCTTTGTGTCCCTATTTGGAATAGCAACCACCAAATA
ATTGGAGTGGCTCAAGTGTTAAACAGACTTGATGGGAAACCTTTTGATGATGCAGATCAA
CGACTTTTTGAGGCTTTTGTCATCTTTTGTGGACTTGGCATCAACAACACAATTATGTAT
GATCAAGTGAAGAAGTCCTGGGCCAAGCAGTCTGTGGCTCTTGATGTGCTATCATACCAT
GCAACATGTTCAAAAGCTGAAGTTGACAAGTTTAAGGCAGCCAACATCCCTCTGGTGTCA
GAACTTGCCATCGATGACATTCATTTTGATGACTTTTCTCTCGACGTTGATGCCATGATC
ACAGCTGCTCTCCGGATGTTCATGGAGCTGGGGATGGTACAGAAATTTAAAATTGACTAT
GAGACACTGTGTAGGTGGCTTTTGACAGTGAGGAAAAACTATCGGATGGTTCTATACCAC
AACTGGAGACATGCCTTCAACGTGTGTCAGCTGATGTTCGCGATGTTAACCACTGCTGGG
TTTCAAGACATTCTGACCGAGGTGGAAATTTTAGCGGTGATTGTGGGATGCCTGTGTCAT
GACCTCGACCACAGGGGAACCAACAATGCCTTCCAAGCTAAGAGTGGCTCTGCCCTGGCC
CAACTCTATGGAACCTCTGCTACCTTGGAGCATCACCATTTCAACCACGCCGTGATGATC
CTTCAAAGTGAGGGTCACAATATCTTTGCTAACCTGTCCTCCAAGGAATATAGTGACCTT
ATGCAGCTTTTGAAGCAGTCAATATTGGCAACAGACCTCACGCTGTACTTTGAGAGGAGA
ACTGAATTCTTTGAACTTGTCAGTAAAGGAGAATACGATTGGAACATCAAAAACCATCGT
GATATATTTCGATCAATGTTAATGACAGCCTGTGACCTTGGAGCCGTGACCAAACCGTGG
GAGATCTCCAGACAGGTGGCAGAACTTGTAACCAGTGAGTTCTTCGAACAAGGAGATCGG
GAGAGATTAGAGCTCAAACTCACTCCTTCAGCAATTTTTGATCGGAACCGGAAGGATGAA
CTGCCTCGGTTGCAACTGGAGTGGATTGATAGCATCTGCATGCCTTTGTATCAGGCACTG
GTGAAGGTCAACGTGAAACTGAAGCCGATGCTAGATTCAGTAGCTACAAACAGAAGTAAG
TGGGAAGAGCTACACCAAAAACGACTGCTGGCCTCAACTGCCTCATCCTCCCCTGCCAGT
GTTATGGTAGCCAAGGAAGACAGGAACTAA
Chromosome Location
2
Locus
2q31.2
External Identifiers
ResourceLink
UniProtKB IDQ9HCR9
UniProtKB Entry NamePDE11_HUMAN
GenBank Protein ID10716052
GenBank Gene IDAB036704
HGNC IDHGNC:8773
General References
  1. Yuasa K, Kotera J, Fujishige K, Michibata H, Sasaki T, Omori K: Isolation and characterization of two novel phosphodiesterase PDE11A variants showing unique structure and tissue-specific expression. J Biol Chem. 2000 Oct 6;275(40):31469-79. [PubMed:10906126]
  2. Fawcett L, Baxendale R, Stacey P, McGrouther C, Harrow I, Soderling S, Hetman J, Beavo JA, Phillips SC: Molecular cloning and characterization of a distinct human phosphodiesterase gene family: PDE11A. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3702-7. [PubMed:10725373]
  3. Hetman JM, Robas N, Baxendale R, Fidock M, Phillips SC, Soderling SH, Beavo JA: Cloning and characterization of two splice variants of human phosphodiesterase 11A. Proc Natl Acad Sci U S A. 2000 Nov 7;97(23):12891-5. [PubMed:11050148]
  4. Yuasa K, Kanoh Y, Okumura K, Omori K: Genomic organization of the human phosphodiesterase PDE11A gene. Evolutionary relatedness with other PDEs containing GAF domains. Eur J Biochem. 2001 Jan;268(1):168-78. [PubMed:11121118]
  5. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Loughney K, Taylor J, Florio VA: 3',5'-cyclic nucleotide phosphodiesterase 11A: localization in human tissues. Int J Impot Res. 2005 Jul-Aug;17(4):320-5. [PubMed:15800651]
  8. Francis SH: Phosphodiesterase 11 (PDE11): is it a player in human testicular function? Int J Impot Res. 2005 Sep-Oct;17(5):467-8. [PubMed:16079899]
  9. Gross-Langenhoff M, Hofbauer K, Weber J, Schultz A, Schultz JE: cAMP is a ligand for the tandem GAF domain of human phosphodiesterase 10 and cGMP for the tandem GAF domain of phosphodiesterase 11. J Biol Chem. 2006 Feb 3;281(5):2841-6. Epub 2005 Dec 5. [PubMed:16330539]
  10. Horvath A, Boikos S, Giatzakis C, Robinson-White A, Groussin L, Griffin KJ, Stein E, Levine E, Delimpasi G, Hsiao HP, Keil M, Heyerdahl S, Matyakhina L, Libe R, Fratticci A, Kirschner LS, Cramer K, Gaillard RC, Bertagna X, Carney JA, Bertherat J, Bossis I, Stratakis CA: A genome-wide scan identifies mutations in the gene encoding phosphodiesterase 11A4 (PDE11A) in individuals with adrenocortical hyperplasia. Nat Genet. 2006 Jul;38(7):794-800. Epub 2006 Jun 11. [PubMed:16767104]
  11. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00820Tadalafilapproved, investigationalunknowninhibitorDetails
DB00201CaffeineapprovedunknowninhibitorDetails
DB09283TrapidilexperimentalyesinhibitorDetails