Cytosolic leucyl-tRNA synthetase

Details

Name
Cytosolic leucyl-tRNA synthetase
Synonyms
Not Available
Gene Name
CDC60
Organism
Yeast
Amino acid sequence
>lcl|BSEQ0021988|Cytosolic leucyl-tRNA synthetase
MSGPVTFEKTFRRDALIDIEKKYQKVWAEEKVFEVDAPTFEECPIEDVEQVQEAHPKFFA
TMAYPYMNGVLHAGHAFTLSKVEFATGFQRMNGKRALFPLGFHCTGMPIKAAADKIKREV
ELFGSDFSKAPIDDEDAEESQQPAKTETKREDVTKFSSKKSKAAAKQGRAKFQYEIMMQL
GIPREEVAKFANTDYWLEFFPPLCQKDVTAFGARVDWRRSMITTDANPYYDAFVRWQINR
LRDVGKIKFGERYTIYSEKDGQACLDHDRQSGEGVGPQEYVGIKIRLTDVAPQAQELFKK
ENLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFQ
NLTPKRGYYKPLFTINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSP
DDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQLA
NAKELAYKEGFYNGTMLIGKYKGDKVEDAKPKVKQDLIDEGLAFVYNEPESQVISRSGDD
CCVSLEDQWYIDYGEEVWLGEALECLKNMETYSKETRHGFEGVLAWMKNWAVTRKFGLGT
KLPWDPQYLVESLSDSTVYMAYYTIDRFLHSDYYGKKAGKFDIKPEQMTDEVFDYIFTRR
DDVETDIPKEQLKEMRREFEYFHPLDVRVSGKDLIPNHLTFFIYTHVALFPKRFWPRGVR
ANGHLLLNNAKMSKSTGNFMTLEQIIEKFGADASRIAMADAGDTVEDANFDEANANAAIL
RLTTLKDWCEEEVKNQDKLRIGDYDSFFDAAFENEMNDLIEKTYQQYTLSNYKQALKSGL
FDFQIARDIYRESVNTTGIGMHKDLVLKYIEYQALMLAPIAPHFAEYLYREVLGKNGSVQ
TSKFPRASKPVSKAILDASEYVRSLTRSIREAEGQALKKKKGKSDVDGSKPISLTVLVSN
TFPEWQDNYIELVRELFEQNKLDDNNVIRQKVGKDMKRGMPYIHQIKTRLATEDADTVFN
RKLTFDEIDTLKNVVEIVKNAPYSLKVEKLEILSFNNGETKGKNIISGEDNIELNFKGKI
MENAVPGEPGIFIKNVE
Number of residues
1097
Molecular Weight
125454.54
Theoretical pI
5.44
GO Classification
Functions
aminoacyl-tRNA editing activity / ATP binding / leucine-tRNA ligase activity
Processes
leucyl-tRNA aminoacylation
Components
cytoplasm
General Function
Leucine-trna ligase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm (By similarity)
Gene sequence
>lcl|BSEQ0004703|3294 bp
ATGAGTGGTCCTGTTACTTTTGAAAAGACATTTCGTAGAGATGCCTTAATCGATATAGAA
AAGAAATATCAAAAGGTATGGGCAGAAGAGAAAGTTTTTGAAGTTGATGCCCCAACTTTT
GAAGAATGTCCTATTGAAGATGTTGAACAAGTTCAAGAAGCACATCCAAAATTCTTTGCC
ACTATGGCTTATCCTTACATGAATGGTGTCTTGCACGCCGGTCATGCCTTTACATTGTCT
AAAGTTGAATTTGCAACTGGGTTCCAAAGAATGAATGGTAAGAGAGCATTATTCCCATTG
GGTTTCCATTGTACGGGTATGCCAATTAAAGCAGCTGCCGATAAAATCAAAAGAGAAGTT
GAATTGTTTGGATCTGATTTTTCTAAAGCTCCTATTGATGACGAAGATGCAGAAGAAAGC
CAACAACCAGCTAAAACCGAAACTAAAAGAGAAGATGTCACCAAATTCTCTTCCAAAAAA
TCCAAGGCTGCTGCCAAACAAGGTAGAGCCAAGTTCCAATATGAGATCATGATGCAATTA
GGAATCCCAAGAGAAGAAGTTGCCAAGTTTGCTAACACCGACTACTGGTTAGAGTTTTTC
CCACCATTGTGTCAAAAAGATGTAACTGCTTTTGGGGCTAGAGTTGATTGGAGACGTTCT
ATGATCACAACCGATGCTAATCCTTATTATGATGCATTTGTTAGATGGCAAATTAATAGA
TTGAGAGATGTTGGTAAAATTAAGTTTGGTGAAAGATATACCATTTATTCTGAAAAGGAT
GGCCAAGCATGTTTGGATCACGATAGACAATCTGGTGAAGGTGTTGGTCCACAAGAATAT
GTTGGTATAAAAATCAGATTAACTGATGTAGCACCACAAGCACAAGAACTTTTCAAGAAA
GAGAATCTCGATGTGAAGGAGAACAAAGTTTACTTGGTTGCTGCAACTTTAAGACCAGAA
ACTATGTATGGTCAAACTTGTTGTTTTGTGAGTCCAAAAATTGATTATGGTGTTTTTGAT
GCTGGTAATGGTGACTATTTCATTACCACTGAACGTGCTTTCAAAAATATGTCTTTCCAA
AACTTGACTCCGAAAAGAGGATATTATAAACCACTTTTCACTATCAATGGTAAGACATTG
ATTGGATCTCGAATTGATGCTCCATATGCTGTCAACAAAAACTTGAGAGTTTTGCCTATG
GAAACAGTTCTTGCAACCAAAGGTACTGGTGTGGTCACTTGTGTTCCATCAGATTCTCCA
GATGATTTTGTTACCACAAGAGACTTGGCCAATAAACCAGAGTACTATGGAATTGAAAAA
GACTGGGTACAAACAGATATTGTTCCTATTGTCCATACCGAAAAATACGGTGATAAGTGT
GCTGAGTTTTTGGTTAATGATTTGAAGATACAGTCACCAAAAGATTCTGTGCAGTTGGCC
AACGCCAAGGAATTGGCTTATAAAGAAGGTTTTTACAATGGTACTATGCTTATTGGTAAA
TACAAAGGTGATAAAGTTGAAGACGCCAAGCCTAAAGTCAAACAAGACTTAATTGATGAA
GGTCTTGCTTTTGTTTACAATGAACCAGAATCCCAAGTTATTTCTAGATCTGGTGATGAT
TGTTGTGTATCATTGGAAGATCAATGGTATATTGATTATGGTGAAGAAGTTTGGTTGGGT
GAAGCCTTAGAATGTCTTAAGAACATGGAAACATACTCCAAGGAAACCAGACATGGCTTC
GAAGGTGTTTTAGCTTGGATGAAGAACTGGGCTGTCACCAGAAAATTTGGTTTGGGTACT
AAATTGCCTTGGGATCCTCAATATTTGGTCGAATCTTTGTCAGATTCTACTGTCTATATG
GCTTATTATACTATTGATCGTTTCTTGCATTCAGATTATTACGGTAAGAAGGCAGGTAAG
TTCGACATTAAGCCAGAGCAAATGACTGATGAAGTATTTGATTACATCTTTACTCGTCGT
GATGACGTTGAAACTGACATTCCAAAGGAACAATTGAAGGAAATGAGAAGAGAGTTTGAA
TATTTTCACCCATTAGACGTCAGAGTTTCAGGAAAAGATTTAATCCCAAATCATTTGACA
TTCTTCATCTATACCCATGTCGCCTTGTTCCCAAAAAGATTTTGGCCAAGAGGTGTTAGA
GCCAACGGACATTTGTTGTTGAACAATGCTAAGATGTCCAAATCAACTGGTAACTTTATG
ACTTTAGAACAAATCATTGAAAAATTCGGAGCTGATGCCTCTAGAATTGCTATGGCCGAT
GCAGGTGACACTGTTGAAGATGCCAACTTTGACGAAGCCAATGCTAATGCTGCAATCTTG
AGATTGACAACTTTGAAAGATTGGTGTGAAGAAGAAGTGAAAAACCAAGACAAGTTAAGA
ATTGGTGACTACGATTCCTTCTTTGACGCTGCTTTTGAAAATGAAATGAATGATTTGATT
GAAAAGACTTACCAACAATACACTTTGAGTAATTACAAACAAGCATTGAAATCGGGATTG
TTTGATTTCCAAATCGCCAGAGATATTTATAGAGAAAGTGTAAACACAACAGGGATTGGT
ATGCACAAGGATCTTGTTTTGAAATACATTGAATACCAAGCATTGATGTTAGCTCCAATT
GCTCCTCATTTTGCCGAATACCTTTACAGAGAAGTTTTAGGTAAAAATGGAAGTGTTCAA
ACTAGCAAGTTCCCAAGAGCCTCAAAGCCTGTTTCCAAAGCTATTCTTGATGCTCTGGAA
TATGTCAGAAGCCTTACCAGATCTATCCGTGAAGCAGAAGGTCAAGCTTTGAAAAAGAAG
AAAGGAAAGTCTGATGTTGATGGGTCAAAACCAATCAGCTTGACAGTTTTGGTTTCCAAC
ACTTTCCCAGAATGGCAAGATAACTATATTGAACTTGTCAGAGAATTGTTTGAACAAAAC
AAGTTGGACGACAATAATGTTATAAGACAAAAGGTTGGCAAGGACATGAAACGTGGTATG
CCATACATCCACCAAATTAAAACTAGATTGGCAACTGAAGATGCTGACACTGTTTTCAAC
AGAAAATTGACTTTTGATGAAATCGATACATTGAAAAATGTTGTTGAAATTGTCAAGAAT
GCCCCATACTCTCTTAAAGTTGAAAAATTGGAGATTCTTAGTTTCAATAACGGTGAAACT
AAGGGGAAGAATATTATTAGTGGTGAAGACAATATTGAGCTCAATTTCAAGGGTAAAATA
ATGGAAAATGCTGTACCTGGTGAGCCTGGTATCTTTATTAAAAATGTCGAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9HGT2
UniProtKB Entry NameQ9HGT2_CANAX
GenBank Gene IDAF293346
General References
  1. O'Sullivan JM, Mihr MJ, Santos MA, Tuite MF: The Candida albicans gene encoding the cytoplasmic leucyl-tRNA synthetase: implications for the evolution of CUG codon reassignment. Gene. 2001 Sep 5;275(1):133-40. [PubMed:11574161]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09041Tavaboroleapproved, investigationalyesinhibitorDetails