Glucose-1-phosphate thymidylyltransferase

Details

Name
Glucose-1-phosphate thymidylyltransferase
Synonyms
  • 2.7.7.24
Gene Name
rmlA
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Amino acid sequence
>lcl|BSEQ0022427|Glucose-1-phosphate thymidylyltransferase
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDT
PRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHE
LLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQ
QVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA
TLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Number of residues
293
Molecular Weight
32456.65
Theoretical pI
5.02
GO Classification
Functions
glucose-1-phosphate thymidylyltransferase activity / metal ion binding / nucleotide binding
Processes
extracellular polysaccharide biosynthetic process
General Function
Nucleotide binding
Specific Function
Catalyzes the formation of dTDP-glucose, from dTTP and glucose 1-phosphate, as well as its pyrophosphorolysis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022428|Glucose-1-phosphate thymidylyltransferase (rmlA)
ATGAAACGCAAGGGCATCATCCTCGCCGGAGGCTCGGGCACCCGCCTGCACCCGGCAACG
CTGGCCATCTCCAAGCAGTTGCTGCCGGTGTACGACAAGCCGATGATCTACTACCCGCTC
AGTACCCTGATGCTGGCGGGCATCCGCGAGATACTGATCATCTCGACCCCACAGGACACC
CCACGCTTCCAGCAGTTGCTGGGCGACGGTTCGAACTGGGGCCTGGACCTGCAATATGCC
GTGCAACCGTCGCCGGACGGCCTGGCCCAGGCCTTCCTGATCGGCGAGTCGTTCATCGGC
AACGACCTCAGCGCGCTGGTCCTGGGCGACAACCTCTATTACGGCCACGACTTCCACGAG
TTGCTCGGCAGCGCTTCGCAGCGCCAGACCGGCGCCAGTGTCTTCGCCTACCACGTGCTG
GACCCGGAGCGCTACGGCGTGGTCGAGTTCGACCAGGGCGGCAAGGCCATCAGCCTGGAA
GAGAAGCCACTGGAGCCGAAGTCGAACTACGCGGTCACCGGCCTGTATTTCTACGACCAG
CAGGTGGTGGACATCGCCAGGGACCTGAAGCCTTCGCCGCGCGGCGAGCTGGAGATCACC
GACGTCAACCGCGCCTATCTGGAGCGCGGCCAGCTCAGCGTGGAGATCATGGGCCGCGGC
TACGCCTGGCTGGATACCGGCACCCACGATTCGCTGCTCGAGGCCGGCCAGTTCATCGCC
ACCCTGGAGAACCGCCAGGGTCTCAAGGTGGCCTGCCCGGAAGAGATCGCCTACCGGCAG
AAGTGGATCGACGCCGCGCAACTGGAAAAACTCGCCGCGCCGCTGGCCAAGAACGGCTAC
GGCCAATACCTCAAGCGCCTGCTGACCGAGACCGTGTACTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9HU22
UniProtKB Entry NameQ9HU22_PSEAE
GenBank Gene IDAE004091
General References
  1. Blankenfeldt W, Asuncion M, Lam JS, Naismith JH: The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA). EMBO J. 2000 Dec 15;19(24):6652-63. [PubMed:11118200]
  2. Alphey MS, Pirrie L, Torrie LS, Boulkeroua WA, Gardiner M, Sarkar A, Maringer M, Oehlmann W, Brenk R, Scherman MS, McNeil M, Rejzek M, Field RA, Singh M, Gray D, Westwood NJ, Naismith JH: Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa. ACS Chem Biol. 2013 Feb 15;8(2):387-96. doi: 10.1021/cb300426u. Epub 2012 Nov 28. [PubMed:23138692]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01643Thymidine monophosphateexperimentalunknownDetails
DB02452Thymidine-5'-TriphosphateexperimentalunknownDetails
DB02843alpha-D-glucose-1-phosphateexperimentalunknownDetails
DB037232'-Deoxy-Thymidine-Beta-L-RhamnoseexperimentalunknownDetails
DB037512'deoxy-Thymidine-5'-Diphospho-Alpha-D-GlucoseexperimentalunknownDetails
DB04272Citric acidapproved, nutraceutical, vet_approvedunknownDetails
DB04485Thymidineexperimental, investigationalunknownDetails