Fucose-binding lectin PA-IIL
Details
- Name
- Fucose-binding lectin PA-IIL
- Synonyms
- Not Available
- Gene Name
- lecB
- Organism
- Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
- Amino acid sequence
>lcl|BSEQ0022300|Fucose-binding lectin PA-IIL MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
- Number of residues
- 115
- Molecular Weight
- 11862.99
- Theoretical pI
- 3.83
- GO Classification
- Functionscarbohydrate binding / metal ion binding
- General Function
- Metal ion binding
- Specific Function
- Not Available
- Pfam Domain Function
- PA-IIL (PF07472)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0022301|Fucose-binding lectin PA-IIL (lecB) ATGGCAACACAAGGAGTGTTCACCCTTCCCGCCAACACCCGGTTCGGCGTCACCGCCTTC GCCAACTCGTCCGGAACCCAGACGGTGAACGTGCTGGTCAACAACGAGACGGCCGCGACC TTCAGCGGGCAAAGCACCAATAACGCCGTCATCGGCACCCAGGTGCTCAACTCCGGCAGC AGTGGCAAGGTACAGGTCCAGGTCAGCGTCAACGGCCGCCCCTCGGATCTGGTCTCGGCA CAGGTAATCCTGACCAACGAGCTGAACTTCGCCCTGGTCGGCTCTGAAGACGGCACCGAC AACGACTACAACGACGCCGTCGTGGTGATCAACTGGCCGCTCGGCTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9HYN5 UniProtKB Entry Name Q9HYN5_PSEAE GenBank Gene ID AE004091 - General References
- Mitchell E, Houles C, Sudakevitz D, Wimmerova M, Gautier C, Perez S, Wu AM, Gilboa-Garber N, Imberty A: Structural basis for oligosaccharide-mediated adhesion of Pseudomonas aeruginosa in the lungs of cystic fibrosis patients. Nat Struct Biol. 2002 Dec;9(12):918-21. [Article]
- Loris R, Tielker D, Jaeger KE, Wyns L: Structural basis of carbohydrate recognition by the lectin LecB from Pseudomonas aeruginosa. J Mol Biol. 2003 Aug 22;331(4):861-70. [Article]
- Perret S, Sabin C, Dumon C, Pokorna M, Gautier C, Galanina O, Ilia S, Bovin N, Nicaise M, Desmadril M, Gilboa-Garber N, Wimmerova M, Mitchell EP, Imberty A: Structural basis for the interaction between human milk oligosaccharides and the bacterial lectin PA-IIL of Pseudomonas aeruginosa. Biochem J. 2005 Jul 15;389(Pt 2):325-32. [Article]
- Mitchell EP, Sabin C, Snajdrova L, Pokorna M, Perret S, Gautier C, Hofr C, Gilboa-Garber N, Koca J, Wimmerova M, Imberty A: High affinity fucose binding of Pseudomonas aeruginosa lectin PA-IIL: 1.0 A resolution crystal structure of the complex combined with thermodynamics and computational chemistry approaches. Proteins. 2005 Feb 15;58(3):735-46. [Article]
- Sabin C, Mitchell EP, Pokorna M, Gautier C, Utille JP, Wimmerova M, Imberty A: Binding of different monosaccharides by lectin PA-IIL from Pseudomonas aeruginosa: thermodynamics data correlated with X-ray structures. FEBS Lett. 2006 Feb 6;580(3):982-7. Epub 2006 Jan 19. [Article]
- Adam J, Pokorna M, Sabin C, Mitchell EP, Imberty A, Wimmerova M: Engineering of PA-IIL lectin from Pseudomonas aeruginosa - Unravelling the role of the specificity loop for sugar preference. BMC Struct Biol. 2007 Jun 1;7:36. [Article]
- Marotte K, Sabin C, Preville C, Moume-Pymbock M, Wimmerova M, Mitchell EP, Imberty A, Roy R: X-ray structures and thermodynamics of the interaction of PA-IIL from Pseudomonas aeruginosa with disaccharide derivatives. ChemMedChem. 2007 Sep;2(9):1328-38. [Article]
- Johansson EM, Crusz SA, Kolomiets E, Buts L, Kadam RU, Cacciarini M, Bartels KM, Diggle SP, Camara M, Williams P, Loris R, Nativi C, Rosenau F, Jaeger KE, Darbre T, Reymond JL: Inhibition and dispersion of Pseudomonas aeruginosa biofilms by glycopeptide dendrimers targeting the fucose-specific lectin LecB. Chem Biol. 2008 Dec 22;15(12):1249-57. doi: 10.1016/j.chembiol.2008.10.009. [Article]
- Hauck D, Joachim I, Frommeyer B, Varrot A, Philipp B, Moller HM, Imberty A, Exner TE, Titz A: Discovery of two classes of potent glycomimetic inhibitors of Pseudomonas aeruginosa LecB with distinct binding modes. ACS Chem Biol. 2013 Aug 16;8(8):1775-84. doi: 10.1021/cb400371r. Epub 2013 Jun 28. [Article]