Beta-lactamase VIM-2

Details

Name
Beta-lactamase VIM-2
Synonyms
  • bla vim-2
  • bla-VIM-2
  • blasVIM-2
  • blaVIM2
  • blm
  • Class B beta-lactamase
  • Class B carbapenemase VIM-2
  • Metallo beta lactamase VIM-2
  • Metallo beta-lactamase
  • Metallo-beta-lactamase
  • Metallo-beta-lactamase VIM-2
  • VIM-2
  • VIM-2 metallo-beta-lactamase
  • VIM-2 protein
Gene Name
blaVIM-2
Organism
Pseudomonas aeruginosa
Amino acid sequence
>lcl|BSEQ0006123|Beta-lactamase VIM-2
MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV
GGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGH
GLPGGLDLLKHTTNVVKAHTNRSVVE
Number of residues
266
Molecular Weight
28326.655
Theoretical pI
4.81
GO Classification
Functions
hydrolase activity / metal ion binding
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0006122|801 bp
ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCG
AGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCG
GTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAG
TCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTG
CTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAG
AAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTC
GGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGC
CGGCTAGCCGAGGTAGAGGGGAACGAGATTCCCACGCACTCTCTAGAAGGACTCTCATCG
AGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTCG
ACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATT
TATGAGTTGTCACGCACGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCC
ACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACAGTTCGTCATTCCGGGGCAC
GGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACA
AATCGCTCAGTCGTTGAGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9K2N0
UniProtKB Entry NameQ9K2N0_PSEAI
GenBank Gene IDAF191564
General References
  1. Poirel L, Naas T, Nicolas D, Collet L, Bellais S, Cavallo JD, Nordmann P: Characterization of VIM-2, a carbapenem-hydrolyzing metallo-beta-lactamase and its plasmid- and integron-borne gene from a Pseudomonas aeruginosa clinical isolate in France. Antimicrob Agents Chemother. 2000 Apr;44(4):891-7. [Article]
  2. Poirel L, Lambert T, Turkoglu S, Ronco E, Gaillard J, Nordmann P: Characterization of Class 1 integrons from Pseudomonas aeruginosa that contain the bla(VIM-2) carbapenem-hydrolyzing beta-lactamase gene and of two novel aminoglycoside resistance gene cassettes. Antimicrob Agents Chemother. 2001 Feb;45(2):546-52. [Article]
  3. Pallecchi L, Riccio ML, Docquier JD, Fontana R, Rossolini GM: Molecular heterogeneity of bla(VIM-2)-containing integrons from Pseudomonas aeruginosa plasmids encoding the VIM-2 metallo-beta-lactamase. FEMS Microbiol Lett. 2001 Feb 20;195(2):145-50. [Article]
  4. Lee K, Lim JB, Yum JH, Yong D, Chong Y, Kim JM, Livermore DM: bla(VIM-2) cassette-containing novel integrons in metallo-beta-lactamase-producing Pseudomonas aeruginosa and Pseudomonas putida isolates disseminated in a Korean hospital. Antimicrob Agents Chemother. 2002 Apr;46(4):1053-8. [Article]
  5. Riccio ML, Docquier JD, Dell'Amico E, Luzzaro F, Amicosante G, Rossolini GM: Novel 3-N-aminoglycoside acetyltransferase gene, aac(3)-Ic, from a Pseudomonas aeruginosa integron. Antimicrob Agents Chemother. 2003 May;47(5):1746-8. [Article]
  6. Walsh TR, Toleman MA, Hryniewicz W, Bennett PM, Jones RN: Evolution of an integron carrying blaVIM-2 in Eastern Europe: report from the SENTRY Antimicrobial Surveillance Program. J Antimicrob Chemother. 2003 Jul;52(1):116-9. Epub 2003 Jun 12. [Article]
  7. Yatsuyanagi J, Saito S, Harata S, Suzuki N, Ito Y, Amano K, Enomoto K: Class 1 integron containing metallo-beta-lactamase gene blaVIM-2 in Pseudomonas aeruginosa clinical strains isolated in Japan. Antimicrob Agents Chemother. 2004 Feb;48(2):626-8. [Article]
  8. Mendes RE, Castanheira M, Garcia P, Guzman M, Toleman MA, Walsh TR, Jones RN: First isolation of bla(VIM-2) in Latin America: report from the SENTRY Antimicrobial Surveillance Program. Antimicrob Agents Chemother. 2004 Apr;48(4):1433-4. [Article]
  9. Quinteira S, Sousa JC, Peixe L: Characterization of In100, a new integron carrying a metallo-{beta}-lactamase and a carbenicillinase, from Pseudomonas aeruginosa. Antimicrob Agents Chemother. 2005 Jan;49(1):451-3. [Article]
  10. Lolans K, Queenan AM, Bush K, Sahud A, Quinn JP: First nosocomial outbreak of Pseudomonas aeruginosa producing an integron-borne metallo-beta-lactamase (VIM-2) in the United States. Antimicrob Agents Chemother. 2005 Aug;49(8):3538-40. [Article]
  11. Fiett J, Baraniak A, Mrowka A, Fleischer M, Drulis-Kawa Z, Naumiuk L, Samet A, Hryniewicz W, Gniadkowski M: Molecular epidemiology of acquired-metallo-beta-lactamase-producing bacteria in Poland. Antimicrob Agents Chemother. 2006 Mar;50(3):880-6. [Article]
  12. Lagatolla C, Edalucci E, Dolzani L, Riccio ML, De Luca F, Medessi E, Rossolini GM, Tonin EA: Molecular evolution of metallo-beta-lactamase-producing Pseudomonas aeruginosa in a nosocomial setting of high-level endemicity. J Clin Microbiol. 2006 Jul;44(7):2348-53. [Article]
  13. Gutierrez O, Juan C, Cercenado E, Navarro F, Bouza E, Coll P, Perez JL, Oliver A: Molecular epidemiology and mechanisms of carbapenem resistance in Pseudomonas aeruginosa isolates from Spanish hospitals. Antimicrob Agents Chemother. 2007 Dec;51(12):4329-35. Epub 2007 Oct 15. [Article]
  14. Corvec S, Poirel L, Espaze E, Giraudeau C, Drugeon H, Nordmann P: Long-term evolution of a nosocomial outbreak of Pseudomonas aeruginosa producing VIM-2 metallo-enzyme. J Hosp Infect. 2008 Jan;68(1):73-82. [Article]
  15. Garcia-Saez I, Docquier JD, Rossolini GM, Dideberg O: The three-dimensional structure of VIM-2, a Zn-beta-lactamase from Pseudomonas aeruginosa in its reduced and oxidised form. J Mol Biol. 2008 Jan 18;375(3):604-11. Epub 2007 Nov 13. [Article]
  16. Libisch B, Watine J, Balogh B, Gacs M, Muzslay M, Szabo G, Fuzi M: Molecular typing indicates an important role for two international clonal complexes in dissemination of VIM-producing Pseudomonas aeruginosa clinical isolates in Hungary. Res Microbiol. 2008 Apr;159(3):162-8. doi: 10.1016/j.resmic.2007.12.008. Epub 2008 Jan 11. [Article]
  17. Samuelsen O, Buaro L, Toleman MA, Giske CG, Hermansen NO, Walsh TR, Sundsfjord A: The first metallo-beta-lactamase identified in norway is associated with a TniC-like transposon in a Pseudomonas aeruginosa isolate of sequence type 233 imported from Ghana. Antimicrob Agents Chemother. 2009 Jan;53(1):331-2. doi: 10.1128/AAC.00785-08. Epub 2008 Nov 17. [Article]
  18. Siarkou VI, Vitti D, Protonotariou E, Ikonomidis A, Sofianou D: Molecular epidemiology of outbreak-related pseudomonas aeruginosa strains carrying the novel variant blaVIM-17 metallo-beta-lactamase gene. Antimicrob Agents Chemother. 2009 Apr;53(4):1325-30. doi: 10.1128/AAC.01230-08. Epub 2009 Jan 21. [Article]
  19. Patzer JA, Walsh TR, Weeks J, Dzierzanowska D, Toleman MA: Emergence and persistence of integron structures harbouring VIM genes in the Children's Memorial Health Institute, Warsaw, Poland, 1998-2006. J Antimicrob Chemother. 2009 Feb;63(2):269-73. doi: 10.1093/jac/dkn512. Epub 2008 Dec 18. [Article]
  20. Jeong JH, Shin KS, Lee JW, Park EJ, Son SY: Analysis of a novel class 1 integron containing metallo-beta-lactamase gene VIM-2 in Pseudomonas aeruginosa. J Microbiol. 2009 Dec;47(6):753-9. doi: 10.1007/s12275-008-0272-2. Epub 2010 Feb 4. [Article]
  21. Samuelsen O, Toleman MA, Sundsfjord A, Rydberg J, Leegaard TM, Walder M, Lia A, Ranheim TE, Rajendra Y, Hermansen NO, Walsh TR, Giske CG: Molecular epidemiology of metallo-beta-lactamase-producing Pseudomonas aeruginosa isolates from Norway and Sweden shows import of international clones and local clonal expansion. Antimicrob Agents Chemother. 2010 Jan;54(1):346-52. doi: 10.1128/AAC.00824-09. Epub 2009 Nov 2. [Article]
  22. Hammami S, Gautier V, Ghozzi R, Da Costa A, Ben-Redjeb S, Arlet G: Diversity in VIM-2-encoding class 1 integrons and occasional blaSHV2a carriage in isolates of a persistent, multidrug-resistant Pseudomonas aeruginosa clone from Tunis. Clin Microbiol Infect. 2010 Feb;16(2):189-93. doi: 10.1111/j.1469-0691.2009.03023.x. Epub 2009 Aug 17. [Article]
  23. Rojo-Bezares B, Estepa V, de Toro M, Undabeitia E, Olarte I, Torres C, Saenz Y: A novel class 1 integron array carrying blaVIM-2 genes and a new insertion sequence in a Pseudomonas aeruginosa strain isolated from a Spanish hospital. J Med Microbiol. 2011 Jul;60(Pt 7):1053-4. doi: 10.1099/jmm.0.030973-0. Epub 2011 Mar 24. [Article]
  24. Touati M, Diene SM, Dekhil M, Djahoudi A, Racherache A, Rolain JM: Dissemination of a class I integron carrying VIM-2 carbapenemase in Pseudomonas aeruginosa clinical isolates from a hospital intensive care unit in Annaba, Algeria. Antimicrob Agents Chemother. 2013 May;57(5):2426-7. doi: 10.1128/AAC.00032-13. Epub 2013 Mar 4. [Article]
  25. Bonnin RA, Poirel L, Nordmann P, Eikmeyer FG, Wibberg D, Puhler A, Schluter A: Complete sequence of broad-host-range plasmid pNOR-2000 harbouring the metallo-beta-lactamase gene blaVIM-2 from Pseudomonas aeruginosa. J Antimicrob Chemother. 2013 May;68(5):1060-5. doi: 10.1093/jac/dks526. Epub 2013 Jan 25. [Article]
  26. Kim MJ, Bae IK, Jeong SH, Kim SH, Song JH, Choi JY, Yoon SS, Thamlikitkul V, Hsueh PR, Yasin RM, Lalitha MK, Lee K: Dissemination of metallo-beta-lactamase-producing Pseudomonas aeruginosa of sequence type 235 in Asian countries. J Antimicrob Chemother. 2013 Dec;68(12):2820-4. doi: 10.1093/jac/dkt269. Epub 2013 Jul 9. [Article]
  27. Jeannot K, Guessennd N, Fournier D, Muller E, Gbonon V, Plesiat P: Outbreak of metallo-beta-lactamase VIM-2-positive strains of Pseudomonas aeruginosa in the Ivory Coast. J Antimicrob Chemother. 2013 Dec;68(12):2952-4. doi: 10.1093/jac/dkt296. Epub 2013 Jul 25. [Article]
  28. Papagiannitsis CC, Studentova V, Ruzicka F, Tejkalova R, Hrabak J: Molecular characterization of metallo-beta-lactamase-producing Pseudomonas aeruginosa in a Czech hospital (2009-2011). J Med Microbiol. 2013 Jun;62(Pt 6):945-7. doi: 10.1099/jmm.0.056119-0. Epub 2013 Mar 14. [Article]
  29. Perez F, Hujer AM, Marshall SH, Ray AJ, Rather PN, Suwantarat N, Dumford D 3rd, O'Shea P, Domitrovic TN, Salata RA, Chavda KD, Chen L, Kreiswirth BN, Vila AJ, Haussler S, Jacobs MR, Bonomo RA: Extensively drug-resistant pseudomonas aeruginosa isolates containing blaVIM-2 and elements of Salmonella genomic island 2: a new genetic resistance determinant in Northeast Ohio. Antimicrob Agents Chemother. 2014 Oct;58(10):5929-35. doi: 10.1128/AAC.02372-14. Epub 2014 Jul 28. [Article]
  30. Guzvinec M, Izdebski R, Butic I, Jelic M, Abram M, Koscak I, Baraniak A, Hryniewicz W, Gniadkowski M, Tambic Andrasevic A: Sequence types 235, 111, and 132 predominate among multidrug-resistant pseudomonas aeruginosa clinical isolates in Croatia. Antimicrob Agents Chemother. 2014 Oct;58(10):6277-83. doi: 10.1128/AAC.03116-14. Epub 2014 Jul 28. [Article]
  31. Aitha M, Marts AR, Bergstrom A, Moller AJ, Moritz L, Turner L, Nix JC, Bonomo RA, Page RC, Tierney DL, Crowder MW: Biochemical, mechanistic, and spectroscopic characterization of metallo-beta-lactamase VIM-2. Biochemistry. 2014 Nov 25;53(46):7321-31. doi: 10.1021/bi500916y. Epub 2014 Nov 13. [Article]
  32. Brem J, van Berkel SS, Aik W, Rydzik AM, Avison MB, Pettinati I, Umland KD, Kawamura A, Spencer J, Claridge TD, McDonough MA, Schofield CJ: Rhodanine hydrolysis leads to potent thioenolate mediated metallo-beta-lactamase inhibition. Nat Chem. 2014 Dec;6(12):1084-90. doi: 10.1038/nchem.2110. Epub 2014 Nov 17. [Article]
  33. Moyo S, Haldorsen B, Aboud S, Blomberg B, Maselle SY, Sundsfjord A, Langeland N, Samuelsen O: Identification of VIM-2-producing Pseudomonas aeruginosa from Tanzania is associated with sequence types 244 and 640 and the location of blaVIM-2 in a TniC integron. Antimicrob Agents Chemother. 2015 Jan;59(1):682-5. doi: 10.1128/AAC.01436-13. Epub 2014 Oct 20. [Article]
  34. Brem J, van Berkel SS, Zollman D, Lee SY, Gileadi O, McHugh PJ, Walsh TR, McDonough MA, Schofield CJ: Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers. Antimicrob Agents Chemother. 2015 Oct 19;60(1):142-50. doi: 10.1128/AAC.01335-15. [Article]
  35. Wright LL, Turton JF, Hopkins KL, Livermore DM, Woodford N: Genetic environment of metallo-beta-lactamase genes in Pseudomonas aeruginosa isolates from the UK. J Antimicrob Chemother. 2015 Dec;70(12):3250-8. doi: 10.1093/jac/dkv263. Epub 2015 Aug 27. [Article]
  36. Belotti PT, Thabet L, Laffargue A, Andre C, Coulange-Mayonnove L, Arpin C, Messadi A, M'Zali F, Quentin C, Dubois V: Description of an original integron encompassing blaVIM-2, qnrVC1 and genes encoding bacterial group II intron proteins in Pseudomonas aeruginosa. J Antimicrob Chemother. 2015 Aug;70(8):2237-40. doi: 10.1093/jac/dkv103. Epub 2015 May 14. [Article]
  37. Christopeit T, Carlsen TJ, Helland R, Leiros HK: Discovery of Novel Inhibitor Scaffolds against the Metallo-beta-lactamase VIM-2 by Surface Plasmon Resonance (SPR) Based Fragment Screening. J Med Chem. 2015 Nov 12;58(21):8671-82. doi: 10.1021/acs.jmedchem.5b01289. Epub 2015 Oct 27. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03661L-cysteic acidexperimentalunknownDetails