Membrane protein

Details

Name
Membrane protein
Synonyms
  • Outer membrane porin C
  • Outer membrane protein C
  • Uncharacterized protein
Gene Name
ompC
Organism
Escherichia coli
Amino acid sequence
>lcl|BSEQ0017274|Membrane protein
MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKVDGLHYFSDNDSKDGDKTYMRLG
FKGETQVTDQLTGYGQWEYQIQGNEPESDNSSWTRVAFAGLKFQDVGSFDYGRNYGVVYD
VTSWTDVLPEFGGDTYDSDNFMQQRGNGFATYRNTDFFGLVDGLDFAVQYQGKNGSAHGE
GMTTNGRDDVFEQNGDGVGGSITYNYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYT
GGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKG
KNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGL
VYQF
Number of residues
364
Molecular Weight
40311.865
Theoretical pI
4.3
GO Classification
Functions
porin activity
Processes
ion transport
Components
cell outer membrane / pore complex
General Function
Porin activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell outer membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9K597
UniProtKB Entry NameQ9K597_ECOLX
GenBank Protein ID166079762
GenBank Gene IDEU372012
General References
  1. Liu YF, Yan JJ, Ko WC, Tsai SH, Wu JJ: Characterization of carbapenem-non-susceptible Escherichia coli isolates from a university hospital in Taiwan. J Antimicrob Chemother. 2008 May;61(5):1020-3. doi: 10.1093/jac/dkn049. Epub 2008 Feb 20. [PubMed:18292097]
  2. Yan JJ, Wu JJ, Lee CC, Ko WC, Yang FC: Prevalence and characteristics of ertapenem-nonsusceptible Escherichia coli in a Taiwanese university hospital, 1999 to 2007. Eur J Clin Microbiol Infect Dis. 2010 Nov;29(11):1417-25. doi: 10.1007/s10096-010-1020-1. Epub 2010 Aug 11. [PubMed:20700614]
  3. Lou H, Chen M, Black SS, Bushell SR, Ceccarelli M, Mach T, Beis K, Low AS, Bamford VA, Booth IR, Bayley H, Naismith JH: Altered antibiotic transport in OmpC mutants isolated from a series of clinical strains of multi-drug resistant E. coli. PLoS One. 2011;6(10):e25825. doi: 10.1371/journal.pone.0025825. Epub 2011 Oct 28. [PubMed:22053181]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04233(Hydroxyethyloxy)Tri(Ethyloxy)OctaneexperimentalunknownDetails
DB02415N-Octyl-2-Hydroxyethyl SulfoxideexperimentalunknownDetails
DB13092Meclocyclineexperimental, investigationalunknownsubstrateDetails