Cytochrome c3

Details

Name
Cytochrome c3
Synonyms
  • Cytochrome c3 precursor
Gene Name
cytc3
Organism
Desulfovibrio desulfuricans
Amino acid sequence
>lcl|BSEQ0022044|Cytochrome c3
MKKTLALTCMLALLLAVSAWAAPAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDG
KESYAKCGSSGCHDDLTAKKGEKSLYYVVHAKGELKHTSCLACHSKVVAEKPELKKDLTG
CAKSKCHP
Number of residues
128
Molecular Weight
13795.125
Theoretical pI
8.65
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005702|387 bp
GTGAAAAAAACTCTTGCTCTTACCTGTATGCTGGCCCTGCTTCTTGCCGTGAGCGCCTGG
GCCGCGCCTGCCGTGCCTGACAAGCCTGTCGAAGTCAAAGGCTCGCAAAAGACAGTCATG
TTCCCCCACGCTCCCCACGAAAAAGTGGAATGCGTGACCTGCCACCACCTGGTGGACGGC
AAGGAAAGCTATGCCAAATGCGGCAGCTCCGGCTGCCATGACGATCTGACCGCCAAAAAG
GGCGAAAAGAGCCTGTACTACGTCGTTCACGCCAAGGGCGAACTCAAGCATACGAGCTGC
CTTGCCTGTCACAGCAAGGTGGTGGCTGAAAAGCCCGAGCTCAAGAAAGACCTTACCGGT
TGCGCCAAGTCCAAGTGTCATCCGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9L915
UniProtKB Entry NameQ9L915_DESDE
GenBank Gene IDAF187324
General References
  1. Einsle O, Foerster S, Mann K, Fritz G, Messerschmidt A, Kroneck PM: Spectroscopic investigation and determination of reactivity and structure of the tetraheme cytochrome c3 from Desulfovibrio desulfuricans Essex 6. Eur J Biochem. 2001 May;268(10):3028-35. [PubMed:11358521]
  2. Louro RO, Bento I, Matias PM, Catarino T, Baptista AM, Soares CM, Carrondo MA, Turner DL, Xavier AV: Conformational component in the coupled transfer of multiple electrons and protons in a monomeric tetraheme cytochrome. J Biol Chem. 2001 Nov 23;276(47):44044-51. Epub 2001 Sep 10. [PubMed:11551953]
  3. Bento I, Matias PM, Baptista AM, da Costa PN, van Dongen WM, Saraiva LM, Schneider TR, Soares CM, Carrondo MA: Molecular basis for redox-Bohr and cooperative effects in cytochrome c3 from Desulfovibrio desulfuricans ATCC 27774: crystallographic and modeling studies of oxidized and reduced high-resolution structures at pH 7.6. Proteins. 2004 Jan 1;54(1):135-52. [PubMed:14705030]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails