Matrix metalloproteinase-25

Details

Name
Matrix metalloproteinase-25
Synonyms
  • 3.4.24.-
  • Leukolysin
  • Membrane-type matrix metalloproteinase 6
  • Membrane-type-6 matrix metalloproteinase
  • MMP-25
  • MMP20
  • MMPL1
  • MT-MMP 6
  • MT6-MMP
  • MT6MMP
  • MTMMP6
Gene Name
MMP25
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052106|Matrix metalloproteinase-25
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
Number of residues
562
Molecular Weight
62553.445
Theoretical pI
Not Available
GO Classification
Functions
metalloendopeptidase activity / zinc ion binding
Processes
collagen catabolic process / extracellular matrix organization / hard palate development / inflammatory response / neutrophil degranulation / proteolysis
Components
anchored component of membrane / extracellular matrix / extracellular space / integral component of membrane / membrane / plasma membrane / specific granule membrane
General Function
May activate progelatinase A.
Specific Function
Metalloendopeptidase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0052107|Matrix metalloproteinase-25 (MMP25)
ATGCGGCTGCGGCTCCGGCTTCTGGCGCTGCTGCTTCTGCTGCTGGCACCGCCCGCGCGC
GCCCCGAAGCCCTCGGCGCAGGACGTGAGCCTGGGCGTGGACTGGCTGACTCGCTATGGT
TACCTGCCGCCACCCCACCCTGCCCAGGCCCAGCTGCAGAGCCCTGAGAAGTTGCGCGAT
GCCATCAAAGTCATGCAGAGGTTCGCGGGGCTGCCGGAGACCGGCCGCATGGACCCAGGG
ACAGTGGCCACCATGCGTAAGCCCCGCTGCTCCCTGCCTGACGTGCTGGGGGTGGCGGGG
CTGGTCAGGCGGCGTCGCCGGTACGCTCTGAGCGGCAGCGTGTGGAAGAAGCGAACCCTG
ACATGGAGGGTACGTTCCTTCCCCCAGAGCTCCCAGCTGAGCCAGGAGACCGTGCGGGTC
CTCATGAGCTATGCCCTGATGGCCTGGGGCATGGAGTCAGGCCTCACATTTCATGAGGTG
GATTCCCCCCAGGGCCAGGAGCCCGACATCCTCATCGACTTTGCCCGCGCCTTCCACCAG
GACAGCTACCCCTTCGACGGGTTGGGGGGCACCCTAGCCCATGCCTTCTTCCCTGGGGAG
CACCCCATCTCCGGGGACACTCACTTTGACGATGAGGAGACCTGGACTTTTGGGTCAAAA
GACGGCGAGGGGACCGACCTGTTTGCCGTGGCTGTCCATGAGTTTGGCCACGCCCTGGGC
CTGGGCCACTCCTCAGCCCCCAACTCCATTATGAGGCCCTTCTACCAGGGTCCGGTGGGC
GACCCTGACAAGTACCGCCTGTCTCAGGATGACCGCGATGGCCTGCAGCAACTCTATGGG
AAGGCGCCCCAAACCCCATATGACAAGCCCACAAGGAAACCCCTGGCTCCTCCGCCCCAG
CCCCCGGCCTCGCCCACACACAGCCCATCCTTCCCCATCCCTGATCGATGTGAGGGCAAT
TTTGACGCCATCGCCAACATCCGAGGGGAAACTTTCTTCTTCAAAGGCCCCTGGTTCTGG
CGCCTCCAGCCCTCCGGACAGCTGGTGTCCCCGCGACCCGCACGGCTGCACCGCTTCTGG
GAGGGGCTGCCCGCCCAGGTGAGGGTGGTGCAGGCCGCCTATGCTCGGCACCGAGACGGC
CGAATCCTCCTCTTTAGCGGGCCCCAGTTCTGGGTGTTCCAGGACCGGCAGCTGGAGGGC
GGGGCGCGGCCGCTCACGGAGCTGGGGCTGCCCCCGGGAGAGGAGGTGGACGCCGTGTTC
TCGTGGCCACAGAACGGGAAGACCTACCTGGTCCGCGGCCGGCAGTACTGGCGCTACGAC
GAGGCGGCGGCGCGCCCGGACCCCGGCTACCCTCGCGACCTGAGCCTCTGGGAAGGCGCG
CCCCCCTCCCCTGACGATGTCACCGTCAGCAACGCAGGTGACACCTACTTCTTCAAGGGC
GCCCACTACTGGCGCTTCCCCAAGAACAGCATCAAGACCGAGCCGGACGCCCCCCAGCCC
ATGGGGCCCAACTGGCTGGACTGCCCCGCCCCGAGCTCTGGTCCCCGCGCCCCCAGGCCC
CCCAAAGCGACCCCCGTGTCCGAAACCTGCGATTGTCAGTGCGAGCTCAACCAGGCCGCA
GGACGTTGGCCTGCTCCCATCCCGCTGCTCCTCTTGCCCCTGCTGGTGGGGGGTGTAGCC
TCCCGCTGA
Chromosome Location
16
Locus
16p13.3
External Identifiers
ResourceLink
UniProtKB IDQ9NPA2
UniProtKB Entry NameMMP25_HUMAN
HGNC IDHGNC:14246
General References
  1. Velasco G, Cal S, Merlos-Suarez A, Ferrando AA, Alvarez S, Nakano A, Arribas J, Lopez-Otin C: Human MT6-matrix metalloproteinase: identification, progelatinase A activation, and expression in brain tumors. Cancer Res. 2000 Feb 15;60(4):877-82. [PubMed:10706098]
  2. Pei D: Leukolysin/MMP25/MT6-MMP: a novel matrix metalloproteinase specifically expressed in the leukocyte lineage. Cell Res. 1999 Dec;9(4):291-303. [PubMed:10628838]
  3. Kojima S, Itoh Y, Matsumoto S, Masuho Y, Seiki M: Membrane-type 6 matrix metalloproteinase (MT6-MMP, MMP-25) is the second glycosyl-phosphatidyl inositol (GPI)-anchored MMP. FEBS Lett. 2000 Sep 1;480(2-3):142-6. [PubMed:11034316]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01039FenofibrateapprovedunknowninhibitorDetails
DB00786MarimastatinvestigationalyesinhibitorDetails
DB13873Fenofibric acidapprovedunknownunknownDetails