Toll-like receptor 9

Details

Name
Toll-like receptor 9
Synonyms
  • CD289 antigen
  • Toll-like receptor 9 precursor
Gene Name
TLR9
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002329|Toll-like receptor 9
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Number of residues
1032
Molecular Weight
115858.665
Theoretical pI
8.23
GO Classification
Functions
interleukin-1 receptor binding / siRNA binding / transmembrane signaling receptor activity
Processes
defense response to bacterium / defense response to Gram-negative bacterium / I-kappaB phosphorylation / inflammatory response / innate immune response / insulin receptor signaling pathway / maintenance of gastrointestinal epithelium / MyD88-dependent toll-like receptor signaling pathway / negative regulation of calcium-transporting ATPase activity / negative regulation of interleukin-6 production / negative regulation of interleukin-8 production / negative regulation of NF-kappaB transcription factor activity / negative regulation of toll-like receptor signaling pathway / positive regulation of chemokine production / positive regulation of gene expression / positive regulation of granulocyte macrophage colony-stimulating factor production / positive regulation of I-kappaB kinase/NF-kappaB signaling / positive regulation of inflammatory response / positive regulation of interferon-alpha biosynthetic process / positive regulation of interferon-beta biosynthetic process / positive regulation of interferon-beta production / positive regulation of interferon-gamma biosynthetic process / positive regulation of interleukin-10 production / positive regulation of interleukin-12 production / positive regulation of interleukin-18 production / positive regulation of interleukin-6 production / positive regulation of interleukin-8 production / positive regulation of JNK cascade / positive regulation of JUN kinase activity / positive regulation of NF-kappaB import into nucleus / positive regulation of NF-kappaB transcription factor activity / positive regulation of nitric-oxide synthase biosynthetic process / positive regulation of toll-like receptor signaling pathway / positive regulation of transcription from RNA polymerase II promoter / positive regulation of tumor necrosis factor production / regulation of cytokine secretion / response to molecule of bacterial origin / toll-like receptor 9 signaling pathway / toll-like receptor signaling pathway / tumor necrosis factor production
Components
apical plasma membrane / basolateral plasma membrane / cytoplasm / early phagosome / endolysosome membrane / endoplasmic reticulum / endoplasmic reticulum membrane / endosome / endosome membrane / extracellular region / Golgi membrane / integral component of membrane / lysosome / plasma membrane
General Function
Transmembrane signaling receptor activity
Specific Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Controls lymphocyte response to Helicobacter infection.
Pfam Domain Function
Transmembrane Regions
819-839
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0019078|Toll-like receptor 9 (TLR9)
ATGGGTTTCTGCCGCAGCGCCCTGCACCCGCTGTCTCTCCTGGTGCAGGCCATCATGCTG
GCCATGACCCTGGCCCTGGGTACCTTGCCTGCCTTCCTACCCTGTGAGCTCCAGCCCCAC
GGCCTGGTGAACTGCAACTGGCTGTTCCTGAAGTCTGTGCCCCACTTCTCCATGGCAGCA
CCCCGTGGCAATGTCACCAGCCTTTCCTTGTCCTCCAACCGCATCCACCACCTCCATGAT
TCTGACTTTGCCCACCTGCCCAGCCTGCGGCATCTCAACCTCAAGTGGAACTGCCCGCCG
GTTGGCCTCAGCCCCATGCACTTCCCCTGCCACATGACCATCGAGCCCAGCACCTTCTTG
GCTGTGCCCACCCTGGAAGAGCTAAACCTGAGCTACAACAACATCATGACTGTGCCTGCG
CTGCCCAAATCCCTCATATCCCTGTCCCTCAGCCATACCAACATCCTGATGCTAGACTCT
GCCAGCCTCGCCGGCCTGCATGCCCTGCGCTTCCTATTCATGGACGGCAACTGTTATTAC
AAGAACCCCTGCAGGCAGGCACTGGAGGTGGCCCCGGGTGCCCTCCTTGGCCTGGGCAAC
CTCACCCACCTGTCACTCAAGTACAACAACCTCACTGTGGTGCCCCGCAACCTGCCTTCC
AGCCTGGAGTATCTGCTGTTGTCCTACAACCGCATCGTCAAACTGGCGCCTGAGGACCTG
GCCAATCTGACCGCCCTGCGTGTGCTCGATGTGGGCGGAAATTGCCGCCGCTGCGACCAC
GCTCCCAACCCCTGCATGGAGTGCCCTCGTCACTTCCCCCAGCTACATCCCGATACCTTC
AGCCACCTGAGCCGTCTTGAAGGCCTGGTGTTGAAGGACAGTTCTCTCTCCTGGCTGAAT
GCCAGTTGGTTCCGTGGGCTGGGAAACCTCCGAGTGCTGGACCTGAGTGAGAACTTCCTC
TACAAATGCATCACTAAAACCAAGGCCTTCCAGGGCCTAACACAGCTGCGCAAGCTTAAC
CTGTCCTTCAATTACCAAAAGAGGGTGTCCTTTGCCCACCTGTCTCTGGCCCCTTCCTTC
GGGAGCCTGGTCGCCCTGAAGGAGCTGGACATGCACGGCATCTTCTTCCGCTCACTCGAT
GAGACCACGCTCCGGCCACTGGCCCGCCTGCCCATGCTCCAGACTCTGCGTCTGCAGATG
AACTTCATCAACCAGGCCCAGCTCGGCATCTTCAGGGCCTTCCCTGGCCTGCGCTACGTG
GACCTGTCGGACAACCGCATCAGCGGAGCTTCGGAGCTGACAGCCACCATGGGGGAGGCA
GATGGAGGGGAGAAGGTCTGGCTGCAGCCTGGGGACCTTGCTCCGGCCCCAGTGGACACT
CCCAGCTCTGAAGACTTCAGGCCCAACTGCAGCACCCTCAACTTCACCTTGGATCTGTCA
CGGAACAACCTGGTGACCGTGCAGCCGGAGATGTTTGCCCAGCTCTCGCACCTGCAGTGC
CTGCGCCTGAGCCACAACTGCATCTCGCAGGCAGTCAATGGCTCCCAGTTCCTGCCGCTG
ACCGGTCTGCAGGTGCTAGACCTGTCCCACAATAAGCTGGACCTCTACCACGAGCACTCA
TTCACGGAGCTACCGCGACTGGAGGCCCTGGACCTCAGCTACAACAGCCAGCCCTTTGGC
ATGCAGGGCGTGGGCCACAACTTCAGCTTCGTGGCTCACCTGCGCACCCTGCGCCACCTC
AGCCTGGCCCACAACAACATCCACAGCCAAGTGTCCCAGCAGCTCTGCAGTACGTCGCTG
CGGGCCCTGGACTTCAGCGGCAATGCACTGGGCCATATGTGGGCCGAGGGAGACCTCTAT
CTGCACTTCTTCCAAGGCCTGAGCGGTTTGATCTGGCTGGACTTGTCCCAGAACCGCCTG
CACACCCTCCTGCCCCAAACCCTGCGCAACCTCCCCAAGAGCCTACAGGTGCTGCGTCTC
CGTGACAATTACCTGGCCTTCTTTAAGTGGTGGAGCCTCCACTTCCTGCCCAAACTGGAA
GTCCTCGACCTGGCAGGAAACCAGCTGAAGGCCCTGACCAATGGCAGCCTGCCTGCTGGC
ACCCGGCTCCGGAGGCTGGATGTCAGCTGCAACAGCATCAGCTTCGTGGCCCCCGGCTTC
TTTTCCAAGGCCAAGGAGCTGCGAGAGCTCAACCTTAGCGCCAACGCCCTCAAGACAGTG
GACCACTCCTGGTTTGGGCCCCTGGCGAGTGCCCTGCAAATACTAGATGTAAGCGCCAAC
CCTCTGCACTGCGCCTGTGGGGCGGCCTTTATGGACTTCCTGCTGGAGGTGCAGGCTGCC
GTGCCCGGTCTGCCCAGCCGGGTGAAGTGTGGCAGTCCGGGCCAGCTCCAGGGCCTCAGC
ATCTTTGCACAGGACCTGCGCCTCTGCCTGGATGAGGCCCTCTCCTGGGACTGTTTCGCC
CTCTCGCTGCTGGCTGTGGCTCTGGGCCTGGGTGTGCCCATGCTGCATCACCTCTGTGGC
TGGGACCTCTGGTACTGCTTCCACCTGTGCCTGGCCTGGCTTCCCTGGCGGGGGCGGCAA
AGTGGGCGAGATGAGGATGCCCTGCCCTACGATGCCTTCGTGGTCTTCGACAAAACGCAG
AGCGCAGTGGCAGACTGGGTGTACAACGAGCTTCGGGGGCAGCTGGAGGAGTGCCGTGGG
CGCTGGGCACTCCGCCTGTGCCTGGAGGAACGCGACTGGCTGCCTGGCAAAACCCTCTTT
GAGAACCTGTGGGCCTCGGTCTATGGCAGCCGCAAGACGCTGTTTGTGCTGGCCCACACG
GACCGGGTCAGTGGTCTCTTGCGCGCCAGCTTCCTGCTGGCCCAGCAGCGCCTGCTGGAG
GACCGCAAGGACGTCGTGGTGCTGGTGATCCTGAGCCCTGACGGCCGCCGCTCCCGCTAC
GTGCGGCTGCGCCAGCGCCTCTGCCGCCAGAGTGTCCTCCTCTGGCCCCACCAGCCCAGT
GGTCAGCGCAGCTTCTGGGCCCAGCTGGGCATGGCCCTGACCAGGGACAACCACCACTTC
TATAACCGGAACTTCTGCCAGGGACCCACGGCCGAATAG
Chromosome Location
3
Locus
3p21.3
External Identifiers
ResourceLink
UniProtKB IDQ9NR96
UniProtKB Entry NameTLR9_HUMAN
GenBank Protein ID8099652
GenBank Gene IDAF259262
GenAtlas IDTLR9
HGNC IDHGNC:15633
General References
  1. Du X, Poltorak A, Wei Y, Beutler B: Three novel mammalian toll-like receptors: gene structure, expression, and evolution. Eur Cytokine Netw. 2000 Sep;11(3):362-71. [PubMed:11022119]
  2. Chuang TH, Ulevitch RJ: Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9. Eur Cytokine Netw. 2000 Sep;11(3):372-8. [PubMed:11022120]
  3. Hemmi H, Takeuchi O, Kawai T, Kaisho T, Sato S, Sanjo H, Matsumoto M, Hoshino K, Wagner H, Takeda K, Akira S: A Toll-like receptor recognizes bacterial DNA. Nature. 2000 Dec 7;408(6813):740-5. [PubMed:11130078]
  4. Nakajima T, Ohtani H, Satta Y, Uno Y, Akari H, Ishida T, Kimura A: Natural selection in the TLR-related genes in the course of primate evolution. Immunogenetics. 2008 Dec;60(12):727-35. doi: 10.1007/s00251-008-0332-0. Epub 2008 Sep 23. [PubMed:18810425]
  5. Georgel P, Macquin C, Bahram S: The heterogeneous allelic repertoire of human toll-like receptor (TLR) genes. PLoS One. 2009 Nov 17;4(11):e7803. doi: 10.1371/journal.pone.0007803. [PubMed:19924287]
  6. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  8. Takeshita F, Leifer CA, Gursel I, Ishii KJ, Takeshita S, Gursel M, Klinman DM: Cutting edge: Role of Toll-like receptor 9 in CpG DNA-induced activation of human cells. J Immunol. 2001 Oct 1;167(7):3555-8. [PubMed:11564765]
  9. Doyle SL, Jefferies CA, Feighery C, O'Neill LA: Signaling by Toll-like receptors 8 and 9 requires Bruton's tyrosine kinase. J Biol Chem. 2007 Dec 21;282(51):36953-60. Epub 2007 Oct 11. [PubMed:17932028]
  10. Liu B, Yang Y, Qiu Z, Staron M, Hong F, Li Y, Wu S, Li Y, Hao B, Bona R, Han D, Li Z: Folding of Toll-like receptors by the HSP90 paralogue gp96 requires a substrate-specific cochaperone. Nat Commun. 2010 Sep 21;1:79. doi: 10.1038/ncomms1070. [PubMed:20865800]
  11. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00608Chloroquineapproved, investigational, vet_approvedunknowninhibitorDetails
DB05463ISS-1018investigationalunknownDetails
DB05475GolotimodinvestigationalunknownDetails
DB05530CPG 10101investigationalunknownDetails
DB01611HydroxychloroquineapprovedyesantagonistDetails