Potassium voltage-gated channel subfamily H member 7

Details

Name
Potassium voltage-gated channel subfamily H member 7
Synonyms
  • Eag-related protein 3
  • ERG-3
  • ERG3
  • Ether-a-go-go-related gene potassium channel 3
  • Ether-a-go-go-related protein 3
  • hERG-3
  • Voltage-gated potassium channel subunit Kv11.3
Gene Name
KCNH7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037062|Potassium voltage-gated channel subfamily H member 7
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSFESE
GEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGSEY
QRPIIQLMRTSQPEASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYVHPIRHPSLPDSSLSTVGIVGLHRHVSDPGLPGK
Number of residues
1196
Molecular Weight
134998.525
Theoretical pI
7.77
GO Classification
Functions
inward rectifier potassium channel activity / voltage-gated potassium channel activity
Processes
circadian rhythm / potassium ion transmembrane transport / protein heterooligomerization / regulation of membrane potential / synaptic transmission
Components
integral component of plasma membrane / plasma membrane
General Function
Voltage-gated potassium channel activity
Specific Function
Pore-forming (alpha) subunit of voltage-gated potassium channel. Channel properties may be modulated by cAMP and subunit assembly.
Pfam Domain Function
Transmembrane Regions
413-433 450-470 495-515 522-542 550-570 642-662
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010490|Potassium voltage-gated channel subfamily H member 7 (KCNH7)
ATGCCTGTGCGCAGGGGGCATGTGGCACCACAAAATACATTTCTGGGGACCATCATTCGG
AAATTTGAAGGGCAAAATAAAAAATTTATCATTGCAAATGCCAGAGTGCAGAACTGTGCC
ATCATTTATTGCAACGATGGGTTCTGTGAGATGACTGGTTTCTCCAGGCCAGATGTCATG
CAAAAGCCATGCACCTGCGACTTTCTCCATGGACCCGAGACCAAGAGGCATGATATTGCC
CAAATTGCCCAGGCATTGCTGGGGTCAGAAGAGAGGAAAGTGGAGGTCACCTACTATCAC
AAAAATGGGTCCACTTTTATTTGTAACACTCACATAATTCCAGTGAAAAACCAAGAGGGC
GTGGCTATGATGTTCATCATTAATTTTGAATATGTGACGGATAATGAAAACGCTGCCACC
CCAGAGAGGGTAAACCCAATATTACCAATCAAAACTGTAAACCGGAAATTTTTTGGGTTC
AAATTCCCTGGTCTGAGAGTTCTCACTTACAGAAAGCAGTCCTTACCACAAGAAGACCCC
GATGTGGTGGTCATCGATTCATCTAAACACAGTGATGATTCAGTAGCCATGAAGCATTTT
AAGTCTCCTACAAAAGAAAGCTGCAGCCCCTCTGAAGCAGATGACACAAAAGCTTTGATA
CAGCCCAGCAAATGTTCTCCCTTGGTGAATATATCCGGACCTCTTGACCATTCCTCTCCC
AAAAGGCAATGGGACCGACTCTACCCTGACATGCTGCAGTCAAGTTCCCAGCTGTCCCAT
TCCAGATCAAGGGAAAGCTTATGTAGTATACGGAGAGCATCTTCGGTCCATGATATAGAA
GGATTCGGCGTCCACCCCAAGAACATATTTAGAGACCGACATGCCAGCGAAGACAATGGT
CGCAATGTCAAAGGGCCTTTTAATCATATCAAGTCAAGCCTCCTGGGATCCACATCAGAT
TCAAACCTCAACAAATACAGCACCATTAACAAGATTCCACAGCTCACTCTGAATTTTTCA
GAGGTCAAAACTGAGAAAAAGAATTCATCACCTCCTTCTTCAGATAAAACCATTATTGCA
CCCAAGGTTAAAGATCGAACACACAATGTGACTGAGAAAGTGACCCAGGTTCTCTCTTTA
GGAGCAGATGTCCTACCTGAATACAAACTGCAGACACCACGCATCAACAAGTTTACGATA
TTGCACTACAGCCCTTTCAAGGCAGTCTGGGACTGGCTTATCCTGCTGTTGGTCATATAC
ACTGCTATATTTACTCCCTACTCTGCAGCCTTCCTCCTCAATGACAGAGAAGAACAGAAA
AGACGAGAATGTGGCTATTCTTGTAGCCCTTTGAATGTGGTAGACTTGATTGTGGATATT
ATGTTTATCATAGATATTTTAATAAACTTCAGAACAACATATGTAAATCAGAATGAAGAA
GTGGTAAGTGATCCCGCCAAAATAGCAATACACTACTTCAAAGGCTGGTTCCTGATTGAC
ATGGTTGCAGCAATTCCTTTTGACTTGCTGATTTTTGGATCAGGTTCTGATGAGACAACA
ACATTAATTGGTCTTTTGAAGACTGCCCGACTCCTCCGTCTTGTGCGCGTGGCCAGGAAA
CTGGATCGATATTCAGAATATGGCGCTGCTGTTCTAATGCTCTTAATGTGCATCTTTGCC
CTGATTGCTCACTGGCTGGCTTGCATTTGGTATGCGATTGGGAATGTAGAAAGGCCTTAC
CTGACTGACAAAATCGGATGGTTGGATTCCTTAGGACAGCAAATTGGGAAACGTTACAAT
GACAGTGACTCAAGTTCTGGACCATCCATTAAAGACAAATACGTCACAGCACTTTATTTT
ACCTTCAGCAGTTTAACCAGTGTAGGATTCGGGAATGTGTCTCCTAACACGAATTCGGAG
AAAATCTTTTCAATTTGTGTCATGTTGATTGGCTCACTAATGTATGCAAGCATTTTTGGG
AATGTATCTGCAATTATCCAAAGACTATACTCGGGAACTGCCAGGTACCACATGCAGATG
CTGCGAGTAAAAGAGTTCATTCGCTTTCACCAAATCCCCAACCCTCTGAGGCAACGTCTT
GAAGAATATTTCCAGCACGCATGGACTTACACCAATGGCATTGACATGAACATGGTCCTA
AAGGGTTTCCCAGAATGCTTACAAGCAGACATTTGTCTACATCTCAACCAGACATTGCTG
CAAAACTGCAAAGCCTTTCGGGGGGCAAGTAAAGGTTGCCTTAGAGCTTTGGCAATGAAG
TTCAAAACCACCCATGCACCTCCAGGAGACACCCTCGTTCACTGTGGGGATGTCCTCACT
GCACTTTATTTCTTATCCAGAGGCTCCATTGAAATTCTCAAAGATGACATTGTGGTGGCT
ATTCTGGGAAAAAATGATATATTTGGAGAAATGGTTCATCTTTATGCCAAACCTGGAAAG
TCTAATGCAGATGTAAGAGCCCTCACATACTGTGACTTGCATAAGATTCAGCGAGAAGAC
TTGTTAGAGGTTTTGGATATGTATCCTGAGTTTTCTGATCACTTTCTAACAAACCTAGAG
TTGACTTTCAACCTAAGGCATGAGAGCGCAAAGGCTGATCTCCTACGATCACAATCCATG
AATGATTCAGAAGGAGACAACTGTAAACTAAGAAGAAGGAAATTGTCATTTGAAAGTGAA
GGAGAGAAAGAAAACAGTACAAATGATCCTGAAGACTCTGCAGATACCATAAGACATTAT
CAGAGTTCCAAGAGACACTTTGAAGAGAAAAAAAGCAGATCCTCATCTTTCATCTCCTCC
ATTGATGATGAACAAAAGCCGCTCTTCTCAGGAATAGTAGACTCTTCTCCAGGAATAGGG
AAAGCATCTGGGCTCGATTTTGAAGAAACAGTGCCCACCTCAGGAAGAATGCACATAGAT
AAAAGAAGTCACTCTTGCAAAGATATCACTGACATGCGAAGCTGGGAACGAGAAAATGCA
CATCCCCAGCCTGAAGACTCCAGTCCATCTGCACTTCAGCGAGCTGCCTGGGGTATCTCT
GAAACCGAAAGCGACCTCACCTACGGGGAAGTGGAACAAAGATTAGATCTGCTCCAGGAG
CAACTTAACAGGCTTGAATCCCAAATGACCACTGACATCCAGACCATCTTACAGTTGCTG
CAGAAACAAACCACTGTGGTCCCCCCAGCCTACAGTATGGTAACAGCAGGATCAGAATAT
CAGAGACCCATCATCCAGCTGATGAGAACCAGTCAACCGGAAGCATCCATCAAAACTGAC
CGAAGTTTCAGCCCTTCCTCACAATGTCCTGAATTTCTAGACCTTGAAAAATCTAAACTT
AAATCCAAAGAATCCCTTTCAAGTGGGGTGCATCTGAACACAGCTTCAGAAGACAACTTG
ACTTCACTTTTAAAACAAGACAGTGATCTCTCTTTAGAGCTTCACCTGCGGCAAAGAAAA
ACTTACGTTCATCCAATTAGGCATCCTTCTTTGCCAGATTCATCCCTAAGCACTGTAGGA
ATCGTGGGTCTTCATAGGCATGTTTCTGATCCTGGTCTTCCAGGGAAATAA
Chromosome Location
2
Locus
2q24.2
External Identifiers
ResourceLink
UniProtKB IDQ9NS40
UniProtKB Entry NameKCNH7_HUMAN
GenBank Protein ID4104136
GenBank Gene IDAF032897
GenAtlas IDKCNH7
HGNC IDHGNC:18863
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Bauer CK, Wulfsen I, Schafer R, Glassmeier G, Wimmers S, Flitsch J, Ludecke DK, Schwarz JR: HERG K(+) currents in human prolactin-secreting adenoma cells. Pflugers Arch. 2003 Feb;445(5):589-600. Epub 2002 Dec 6. [PubMed:12634931]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00308IbutilideapprovedunknowninhibitorDetails
DB01162TerazosinapprovedunknowninhibitorDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalyesinhibitorDetails
DB00590DoxazosinapprovedunknowninhibitorDetails
DB00321AmitriptylineapprovedunknownblockerDetails
DB01069Promethazineapproved, investigationalunknowninducerDetails