Potassium voltage-gated channel subfamily D member 1

Details

Name
Potassium voltage-gated channel subfamily D member 1
Synonyms
  • Voltage-gated potassium channel subunit Kv4.1
Gene Name
KCND1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008577|Potassium voltage-gated channel subfamily D member 1
MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGSARRSSREQPCGERFPQAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Number of residues
647
Molecular Weight
71329.6
Theoretical pI
Not Available
GO Classification
Functions
delayed rectifier potassium channel activity / metal ion binding
Processes
potassium ion transmembrane transport / protein homooligomerization / synaptic transmission
Components
dendrite / integral component of membrane / neuronal cell body / plasma membrane / voltage-gated potassium channel complex
General Function
Metal ion binding
Specific Function
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Pfam Domain Function
Transmembrane Regions
185-205 227-247 262-282 292-312 326-346 387-407
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0020801|Potassium voltage-gated channel subfamily D member 1 (KCND1)
ATGGCGGCAGGCCTGGCCACGTGGCTGCCTTTTGCTCGGGCAGCAGCAGTGGGCTGGCTG
CCCCTGGCCCAGCAACCCCTGCCCCCGGCACCGGGGGTGAAGGCATCTCGAGGAGATGAG
GTTCTGGTGGTGAACGTGAGCGGACGGCGCTTTGAGACTTGGAAGAATACGCTGGACCGC
TACCCAGACACCTTGCTGGGCAGCTCGGAGAAGGAATTCTTCTACGATGCTGACTCAGGC
GAGTACTTCTTCGATCGCGACCCTGACATGTTCCGCCATGTGCTGAACTTCTACCGAACG
GGGCGGCTGCATTGCCCACGGCAGGAGTGCATCCAGGCCTTCGACGAAGAGCTGGCTTTC
TACGGCCTGGTTCCCGAGCTAGTCGGTGACTGCTGCCTTGAAGAGTATCGGGACCGAAAG
AAGGAGAATGCCGAGCGCCTGGCAGAGGATGAGGAGGCAGAGCAGGCCGGGGACGGCCCA
GCCCTGCCAGCAGGCAGCTCCCTGCGGCAGCGGCTCTGGCGGGCCTTCGAGAATCCACAC
ACGAGCACCGCAGCCCTCGTTTTCTACTATGTGACCGGCTTCTTCATCGCCGTGTCGGTC
ATCGCCAATGTGGTGGAGACCATCCCATGCCGCGGCTCTGCACGCAGGTCCTCAAGGGAG
CAGCCCTGTGGCGAACGCTTCCCACAGGCCTTTTTCTGCATGGACACAGCCTGTGTACTC
ATATTCACAGGTGAATACCTCCTGCGGCTGTTTGCCGCCCCCAGCCGTTGCCGCTTCCTG
CGGAGTGTCATGAGCCTCATCGACGTGGTGGCCATCCTGCCCTACTACATTGGGCTTTTG
GTGCCCAAGAACGACGATGTCTCTGGCGCCTTTGTCACCCTGCGTGTGTTCCGGGTGTTT
CGCATCTTCAAGTTCTCCAGGCACTCACAGGGCTTGAGGATTCTGGGCTACACACTCAAG
AGCTGTGCCTCTGAGCTGGGCTTTCTCCTCTTTTCCCTAACCATGGCCATCATCATCTTT
GCCACTGTCATGTTTTATGCTGAGAAGGGCACAAACAAGACCAACTTTACAAGCATCCCT
GCGGCCTTCTGGTATACCATTGTCACCATGACCACGCTTGGCTACGGAGACATGGTGCCC
AGCACCATTGCTGGCAAGATTTTCGGGTCCATCTGCTCACTCAGTGGCGTCTTGGTCATT
GCCCTGCCTGTGCCAGTCATTGTGTCCAACTTTAGCCGCATCTACCACCAGAACCAGCGG
GCTGACAAGCGCCGAGCACAGCAGAAGGTGCGCTTGGCAAGGATCCGATTGGCAAAGAGT
GGTACCACCAATGCCTTCCTGCAGTACAAGCAGAATGGGGGCCTTGAGGACAGCGGCAGT
GGCGAGGAACAGGCTCTTTGTGTCAGGAACCGTTCTGCCTTTGAACAGCAACATCACCAC
TTGCTGCACTGTCTAGAGAAGACAACGTGCCATGAGTTCACAGATGAGCTCACCTTCAGT
GAAGCCCTGGGAGCCGTCTCGCCGGGTGGCCGCACCAGCCGTAGCACCTCTGTGTCTTCC
CAGCCAGTGGGACCCGGAAGCCTGCTGTCTTCTTGCTGCCCTCGCAGGGCCAAGCGCCGC
GCCATCCGCCTTGCCAACTCCACTGCCTCAGTCAGCCGTGGCAGCATGCAGGAGCTGGAC
ATGCTGGCAGGGCTGCGCAGGAGCCATGCCCCTCAGAGCCGTTCCAGCCTCAATGCCAAG
CCCCATGACAGCCTTGACCTGAACTGCGACAGCCGGGACTTCGTGGCTGCCATTATCAGC
ATCCCTACCCCTCCTGCCAACACCCCAGATGAGAGCCAACCTTCCTCCCCTGGCGGCGGT
GGCAGGGCCGGCAGCACCCTCAGGAACTCCAGCCTGGGTACCCCTTGCCTCTTCCCCGAG
ACTGTCAAGATCTCATCCCTGTGA
Chromosome Location
X
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9NSA2
UniProtKB Entry NameKCND1_HUMAN
HGNC IDHGNC:6237
General References
  1. Isbrandt D, Leicher T, Waldschutz R, Zhu X, Luhmann U, Michel U, Sauter K, Pongs O: Gene structures and expression profiles of three human KCND (Kv4) potassium channels mediating A-type currents I(TO) and I(SA). Genomics. 2000 Mar 1;64(2):144-54. [PubMed:10729221]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Jerng HH, Qian Y, Pfaffinger PJ: Modulation of Kv4.2 channel expression and gating by dipeptidyl peptidase 10 (DPP10). Biophys J. 2004 Oct;87(4):2380-96. [PubMed:15454437]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06637DalfampridineapprovedyesantagonistDetails