KAT8 regulatory NSL complex subunit 3

Details

Name
KAT8 regulatory NSL complex subunit 3
Synonyms
  • KIAA1310
  • Non-specific lethal 3 homolog
  • NSL complex protein NSL3
  • NSL3
  • PRTD
  • Serum inhibited-related protein
  • SI1
  • Testis development protein PRTD
Gene Name
KANSL3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049891|KAT8 regulatory NSL complex subunit 3
MAHRGGERDFQTSARRMGTSLLFQLSVHERELDLVFLDHSYAKPWSAHPDASSARPTRML
FVTPRRQHESTIESDVPIDVETVTSTPMPLYDNQKARSVMNECERHVIFARTDADAPPPP
EDWEEHVNRTGWTMAQNKLFNKILKALQSDRLARLANEGACNEPVLRRVAVDKCARRVRQ
ALASVSWDTKLIQWLHTTLVETLSLPMLAAYLDALQTLKGKIPTLIDRMLVSSNTKTGAA
GAEALSLLLKRPWDPAVGVLSHNKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLS
CLGKVIPVATHLLNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVA
CHVSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCHPEAMEDFR
EKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMG
SEPRDQDAEKKKKPRDVARRDLAFEVPERGSRPASPAAKLPASPSGSEDLSSVSSSPTSS
PKTKVTTVTSAQKSSQIGSSQLLKRHVQRTEAVLTHKQAQAQFAAFLKQNMLVRKALPPG
TSSCLFVPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGP
CAPSQGSAPEAAGGKPITMTLGQASAGAKELTGLLTTAKSSSSEGGVSASPVPSVVSSST
APSALHTLQSRLVATSPGSSLPGATSASSLLQGLSFSLQDISSKTSGLPANPSPGPAPQA
TSVKLPTPMQSLGAITTGTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLTNGGLAKLAS
SLPGLAQISNQASGLKVPTTITLTLRGQPSRITTLSPMGSGAAPSEESSSQVLPSSSQRL
PPAP
Number of residues
904
Molecular Weight
95990.725
Theoretical pI
Not Available
GO Classification
Processes
histone H4-K16 acetylation / histone H4-K5 acetylation / histone H4-K8 acetylation
Components
histone acetyltransferase complex / intracellular membrane-bounded organelle / nucleolus / nucleoplasm / nucleus
General Function
As part of the NSL complex it is involved in acetylation of nucleosomal histone H4 on several lysine residues and therefore may be involved in the regulation of transcription.
Specific Function
Not Available
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0049892|KAT8 regulatory NSL complex subunit 3 (KANSL3)
ATGGCCCACCGGGGTGGGGAGAGGGACTTCCAGACTTCAGCTCGACGCATGGGCACCTCG
CTGCTCTTCCAGCTTTCAGTGCATGAACGGGAGCTGGACCTGGTTTTTCTGGATCATAGC
TATGCCAAGCCTTGGAGTGCCCACCCAGATGCCAGTAGTGCCCGCCCCACCCGCATGCTC
TTTGTCACTCCCCGGCGGCAGCACGAAAGTACCATTGAATCAGACGTCCCAATAGATGTG
GAGACGGTCACATCAACGCCTATGCCACTCTATGACAATCAGAAGGCACGCAGCGTGATG
AATGAGTGTGAACGGCATGTCATCTTTGCCAGGACTGATGCAGATGCCCCTCCTCCACCA
GAGGACTGGGAGGAGCATGTCAACAGGACTGGCTGGACAATGGCCCAGAACAAGCTATTC
AACAAGATCCTCAAAGCCCTGCAGTCTGACCGGCTTGCCCGCTTGGCCAACGAAGGGGCT
TGTAATGAGCCAGTGCTGCGCCGTGTTGCTGTGGACAAGTGTGCAAGGAGAGTGCGGCAG
GCTCTGGCAAGTGTGAGCTGGGATACCAAGCTGATCCAGTGGCTGCACACCACCCTTGTG
GAGACCTTGAGTCTGCCCATGCTGGCAGCCTACCTGGATGCTTTGCAGACGCTGAAGGGG
AAGATCCCAACCTTGATTGACCGGATGCTTGTGTCATCCAACACAAAGACTGGGGCTGCA
GGAGCTGAGGCCTTGTCTCTCCTACTGAAGAGGCCCTGGGACCCTGCTGTGGGTGTGCTT
TCTCATAACAAACCAAGCAAACTCCCTGGCTCTCCGCTGATTCTCATCGCCTCCTCTGGT
CCCTCCAGCTCTGTGTTTCCCACTTCACGCCGCCACCGCTTCTGGCAATCTCAGCTGTCC
TGCTTGGGCAAGGTCATCCCTGTAGCCACCCATCTGCTGAACAATGGCAGTGGGGTAGGA
GTTCTACAGTGTCTCGAGCATATGATTGGGGCAGTGAGAAGCAAAGTGCTGGAGATTCAC
AGCCATTTCCCACACAAACCCATTATCTTGATTGGCTGGAACACAGGAGCTTTGGTGGCC
TGTCATGTGTCAGTAATGGAGTATGTCACTGCAGTTGTCTGCCTTGGGTTTCCTCTGCTT
ACTGTGGATGGCCCCAGAGGGGATGTAGATGATCCCCTCTTGGATATGAAGACTCCAGTC
CTCTTTGTCATTGGTCAGAATTCCCTTCAATGTCACCCTGAAGCCATGGAGGACTTCCGG
GAGAAGATTCGAGCTGAGAACAGCTTGGTGGTGGTTGGGGGAGCTGATGACAATCTCAGA
ATAAGCAAAGCAAAGAAGAAATCAGAAGGGTTGACTCAGAGCATGGTGGACAGATGTATT
CAGGATGAGATTGTGGACTTTCTGACTGGAGTGCTCACTCGTGCTGAGGGTCACATGGGC
TCTGAACCTCGGGATCAGGATGCTGAGAAGAAGAAGAAGCCCCGCGATGTGGCCCGCAGA
GACTTGGCCTTTGAAGTCCCTGAGCGGGGCAGTCGACCTGCCTCCCCAGCTGCCAAGCTG
CCCGCCTCACCCTCAGGCTCAGAGGATCTCTCCAGTGTGTCCAGCAGCCCCACCTCCAGT
CCCAAGACCAAAGTGACCACAGTGACCTCTGCCCAGAAGTCCAGTCAGATTGGAAGTTCT
CAGCTGCTGAAGAGACATGTGCAGCGGACAGAAGCTGTGCTGACCCACAAACAAGCTCAA
GTTCCCATTTCATCAGAACCACCAGAGGAAGGAGAGAAAGAGGATCTTAGGGTTCAGCTG
AAGCGACACCATCCCTCGAGTCCCCTTCCTGGCAGTAAGACCTCCAAACGACCGAAGATC
AAGGTGTCCCTTATCTCCCAAGGGGACACAGCTGGAGGGCCTTGTGCTCCTTCCCAAGGA
AGTGCTCCAGAAGCTGCAGGTGGGAAGCCCATCACCATGACACTGGGGCAGGCTTCAGCA
GGGGCCAAGGAGCTCACAGGACTTCTCACCACAGCCAAGTCCAGTTCTTCTGAAGGTGGA
GTCTCAGCCAGCCCAGTCCCTTCAGTGGTCTCCAGCAGCACTGCACCCAGTGCCTTGCAC
ACACTGCAGAGCCGCCTGGTGGCCACATCTCCTGGCAGCTCCCTCCCAGGGGCCACATCA
GCCAGCAGCCTCCTCCAAGGCCTCAGCTTCAGCTTGCAGGATATCAGCAGCAAGACCTCT
GGCCTTCCAGCAAATCCCTCCCCAGGACCAGCCCCACAGGCCACCAGTGTGAAGTTGCCC
ACCCCCATGCAGAGCCTGGGTGCCATCACCACGGGCACCAGCACCATTGTCCGTACCATT
CCTGTGGCCACCACTCTCTCCTCCTTGGGTGCCACTCCTGGTGGGAAGCCCACAGCCATC
CACCAGCTGCTGACCAATGGGGGCCTCGCTAAGTTGGCAAGCAGCCTCCCTGGCCTGGCT
CAGATCTCTAACCAAGCATCAGGCTTGAAGGTCCCCACCACCATTACTCTGACACTTCGT
GGCCAGCCGAGCAGGATCACTACACTGAGCCCTATGGGCTCAGGAGCAGCCCCATCCGAG
GAGTCCTCTTCCCAGGTGCTGCCCTCCAGCTCACAGCGCCTGCCTCCAGCACCCTGA
Chromosome Location
2
Locus
2q11.2
External Identifiers
ResourceLink
UniProtKB IDQ9P2N6
UniProtKB Entry NameKANL3_HUMAN
HGNC IDHGNC:25473
General References
  1. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166]
  6. Mendjan S, Taipale M, Kind J, Holz H, Gebhardt P, Schelder M, Vermeulen M, Buscaino A, Duncan K, Mueller J, Wilm M, Stunnenberg HG, Saumweber H, Akhtar A: Nuclear pore components are involved in the transcriptional regulation of dosage compensation in Drosophila. Mol Cell. 2006 Mar 17;21(6):811-23. [PubMed:16543150]
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  10. Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW, Conaway RC: Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex. J Biol Chem. 2010 Feb 12;285(7):4268-72. doi: 10.1074/jbc.C109.087981. Epub 2009 Dec 14. [PubMed:20018852]
  11. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03467NaringeninexperimentalunknownDetails