Aminoglycoside N(6')-acetyltransferase type 1

Details

Name
Aminoglycoside N(6')-acetyltransferase type 1
Synonyms
  • 2.3.1.82
  • AAC(6')-Iy
  • Aminoglycoside resistance protein
Gene Name
Not Available
Organism
Salmonella enteritidis
Amino acid sequence
>lcl|BSEQ0022293|Aminoglycoside N(6')-acetyltransferase type 1
MDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADA
SIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPEN
TISQKVHQALGFEETERVIFYRKRC
Number of residues
145
Molecular Weight
16361.42
Theoretical pI
6.88
GO Classification
Functions
aminoglycoside 6'-N-acetyltransferase activity / protein homodimerization activity
Processes
acetyl-CoA metabolic process / histone acetylation / response to antibiotic
General Function
Protein homodimerization activity
Specific Function
Catalyzes the transfer of an acetyl group from acetyl-CoA to the 6'-amino group of aminoglycoside molecules conferring resistance to antibiotics containing the purpurosamine ring including amikacin, tobramycin, dibekacin and ribostamycin. Able to acetylate eukaryotic histone proteins.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005249|438 bp
ATGGACATCAGGCAAATGAACAAAACCCATCTGGAGCACTGGCGCGGATTGCGAAAACAG
CTCTGGCCTGGTCACCCGGATGACGCCCATCTGGCGGACGGCGAAGAAATTCTGCAAGCC
GATCATCTGGCATCATTTATTGCGATGGCAGACGGGGTGGCGATTGGCTTTGCGGATGCC
TCAATCCGCCACGATTATGTCAATGGCTGTGACAGTTCGCCCGTGGTTTTCCTTGAAGGT
ATTTTTGTTCTCCCCTCATTCCGTCAACGCGGCGTAGCGAAACAATTGATTGCAGCGGTG
CAACGATGGGGAACGAATAAAGGGTGTCGGGAAATGGCCTCCGATACCTCGCCGGAAAAT
ACAATTTCCCAGAAAGTTCATCAGGCGTTAGGATTTGAGGAAACAGAGCGCGTCATTTTC
TACCGAAAGCGTTGTTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9R381
UniProtKB Entry NameAAC6_SALEN
GenBank Gene IDAF144881
General References
  1. Magnet S, Courvalin P, Lambert T: Activation of the cryptic aac(6')-Iy aminoglycoside resistance gene of Salmonella by a chromosomal deletion generating a transcriptional fusion. J Bacteriol. 1999 Nov;181(21):6650-5. [PubMed:10542165]
  2. Vetting MW, Magnet S, Nieves E, Roderick SL, Blanchard JS: A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones. Chem Biol. 2004 Apr;11(4):565-73. [PubMed:15123251]
  3. Magalhaes ML, Vetting MW, Gao F, Freiburger L, Auclair K, Blanchard JS: Kinetic and structural analysis of bisubstrate inhibition of the Salmonella enterica aminoglycoside 6'-N-acetyltransferase. Biochemistry. 2008 Jan 15;47(2):579-84. Epub 2007 Dec 21. [PubMed:18095712]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01992Coenzyme Ainvestigational, nutraceuticalunknownDetails
DB03615Ribostamycinapproved, experimentalunknownDetails