Nine-heme cytochrome c

Details

Name
Nine-heme cytochrome c
Synonyms
  • 9Hcc
Gene Name
Not Available
Organism
Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)
Amino acid sequence
>lcl|BSEQ0016912|Nine-heme cytochrome c
MRNGTSLLLLAAIALAGAACLTAMGGTAKAAALEPTDSGAPSAIVMFPVGEKPNPKGAAM
KPVVFNHLIHEKKIDNCETCHHTGDPVSCSTCHTVEGKAEGNYITLDRAMHATNIAKRAK
GNTPVSCVSCHEQQTKERRECAGCHAIVTPKRDEAWCATCHNITPSMTPEQMQKGINGTL
LPGDNEALAAETVLAQKTVEPVSPMLAPYKVVIDALADKYEPSNFTHRRHLTSLMERIKD
DKLAQAFHNKPEILCATCHHRSPLSLTPPKCGSCHTKEIDKANPGRPNLMAAYHLQCMGC
HKGMDVARPRDTDCTTCHKAAPKSAD
Number of residues
326
Molecular Weight
35024.955
Theoretical pI
7.97
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
oxidation-reduction process
Components
periplasmic space
General Function
Metal ion binding
Specific Function
May form part of a transmembrane redox complex through which electrons are transferred to the cytoplasm for reduction of sulfate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0016913|Nine-heme cytochrome c
ATGAGGAACGGCACATCACTGCTTCTGCTGGCGGCTATAGCCCTGGCTGGCGCGGCGTGT
CTCACGGCGATGGGAGGCACGGCCAAGGCCGCAGCCCTGGAGCCAACAGACAGCGGCGCG
CCATCGGCTATAGTCATGTTTCCGGTCGGCGAAAAGCCCAATCCCAAGGGCGCGGCCATG
AAACCCGTGGTTTTCAACCATCTTATCCACGAAAAGAAGATTGACAACTGCGAGACCTGT
CACCACACGGGCGATCCGGTGTCCTGTAGCACCTGTCACACGGTAGAAGGCAAGGCCGAG
GGCAATTACATCACCCTTGACCGCGCCATGCATGCCACCAATATCGCCAAACGCGCCAAG
GGCAACACGCCCGTCAGCTGCGTGAGCTGTCACGAACAGCAAACCAAAGAGCGGCGCGAA
TGCGCGGGTTGTCACGCCATTGTCACGCCCAAGCGTGACGAGGCATGGTGCGCCACCTGC
CACAACATCACGCCTTCAATGACGCCCGAACAGATGCAGAAGGGCATTAACGGCACCCTG
CTGCCCGGCGATAACGAAGCTCTGGCGGCAGAAACCGTGCTGGCCCAGAAGACCGTTGAG
CCTGTTTCCCCCATGCTGGCCCCCTACAAGGTGGTCATTGATGCCCTGGCTGACAAGTAC
GAGCCGAGCAACTTTACCCACCGCCGCCACCTCACGTCCCTTATGGAAAGAATCAAGGAC
GACAAGCTGGCCCAGGCTTTCCACAACAAGCCTGAAATCCTGTGCGCTACCTGCCACCAC
AGAAGCCCGCTTTCCCTTACGCCTCCCAAGTGCGGCAGCTGCCACACCAAGGAGATCGAC
AAGGCCAATCCCGGTCGTCCCAACCTTATGGCCGCCTACCATCTGCAGTGCATGGGTTGC
CACAAGGGCATGGATGTCGCGCGTCCTCGTGACACCGACTGCACCACTTGCCATAAGGCT
GCGCCCAAGAGCGCCGACTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9RN68
UniProtKB Entry NameCYC9_DESDA
GenBank Gene IDAF186393
General References
  1. Saraiva LM, da Costa PN, LeGall J: Sequencing the gene encoding desulfovibrio desulfuricans ATCC 27774 nine-heme cytochrome c. Biochem Biophys Res Commun. 1999 Sep 7;262(3):629-34. [PubMed:10471375]
  2. Matias PM, Saraiva LM, Soares CM, Coelho AV, LeGall J, Carrondo MA: Nine-haem cytochrome c from Desulfovibrio desulfuricans ATCC 27774:primary sequence determination, crystallographic refinement at 1.8 and modelling studies of its interaction with the tetrahaem cytochrome c3. J Biol Inorg Chem. 1999 Aug;4(4):478-94. [PubMed:10555582]
  3. Matias PM, Coelho R, Pereira IA, Coelho AV, Thompson AW, Sieker LC, Gall JL, Carrondo MA: The primary and three-dimensional structures of a nine-haem cytochrome c from Desulfovibrio desulfuricans ATCC 27774 reveal a new member of the Hmc family. Structure. 1999 Feb 15;7(2):119-30. [PubMed:10368280]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails