Cytochrome c''

Details

Name
Cytochrome c''
Synonyms
  • Cytochrome c'' precursor
Gene Name
cycA
Organism
Methylophilus methylotrophus
Amino acid sequence
>lcl|BSEQ0011232|Cytochrome c''
MKIKTIIAVFGVLFSAHALADVTNAEKLVYKYTNIAHSANPMYEAPSITDGKIFFNRKFK
TPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDIL
GADCSPSEKANFIAYLLTETKPTK
Number of residues
144
Molecular Weight
15791.975
Theoretical pI
8.91
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
oxidation-reduction process
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0003424|435 bp
ATGAAAATCAAAACAATCATTGCCGTATTCGGGGTCTTATTTTCTGCTCATGCATTGGCT
GACGTGACTAACGCTGAAAAGTTGGTGTACAAATATACCAATATCGCTCACTCCGCCAAT
CCAATGTATGAAGCGCCTTCAATTACTGATGGCAAAATTTTCTTCAACCGCAAATTCAAA
ACACCAAGCGGCAAAGAAGCGGCGTGTGCATCTTGTCACACCAATAACCCGGCTAATGTA
GGTAAAAACATTGTTACCGGCAAAGAAATCCCACCACTGGCACCACGCGTCAATACCAAA
CGCTTCACAGATATCGACAAAGTAGAAGACGAATTCACCAAACACTGTAATGATATTCTG
GGTGCAGATTGCTCACCTTCAGAAAAAGCTAACTTCATTGCTTATTTGTTGACAGAAACC
AAGCCTACCAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9RQB9
UniProtKB Entry NameCYCA_METME
GenBank Protein ID6478241
GenBank Gene IDAF119838
General References
  1. Price NJ, Vijgenboom E, Ribeiro G, Costa JV, Canters GW, Santos H: Cloning and sequence analysis of the gene encoding Methylophilus methylotrophus cytochrome c", a unique protein with a perpendicular orientation of the histidinyl ligands. Biochim Biophys Acta. 1999 Sep 1;1413(1):55-61. [PubMed:10524262]
  2. Klarskov K, Leys D, Backers K, Costa HS, Santos H, Guisez Y, Van Beeumen JJ: Cytochrome c" from the obligate methylotroph Methylophilus methylotrophus, an unexpected homolog of sphaeroides heme protein from the phototroph Rhodobacter sphaeroides. Biochim Biophys Acta. 1999 May 26;1412(1):47-55. [PubMed:10354493]
  3. Costa HS, Santos H, Turner DL: Characterization of the haem environment in Methylophilus methylotrophus ferricytochrome c" by 1H-NMR. Eur J Biochem. 1993 Aug 1;215(3):817-24. [PubMed:8394812]
  4. Costa HS, Santos H, Turner DL, Xavier AV: Involvement of a labile axial histidine in coupling electron and proton transfer in Methylophilus methylotrophus cytochrome c''. Eur J Biochem. 1992 Sep 1;208(2):427-33. [PubMed:1325909]
  5. Berry MJ, George SJ, Thomson AJ, Santos H, Turner DL: Cytochrome c'' isolated from Methylophilus methylotrophus. An example of bis-histidine-co-ordinated Fe3+ haem, with near-perpendicular orientation of the ligands. Biochem J. 1990 Sep 1;270(2):413-7. [PubMed:2169241]
  6. Enguita FJ, Rodrigues L, Archer M, Sieker L, Rodrigues A, Pohl E, Turner DL, Santos H, Carrondo MA: Crystallization and preliminary X-ray characterization of cytochrome c" from the obligate methylotroph Methylophilus methylotrophus. Acta Crystallogr D Biol Crystallogr. 2003 Mar;59(Pt 3):580-3. Epub 2003 Feb 21. [PubMed:12595732]
  7. Brennan L, Turner DL, Fareleira P, Santos H: Solution structure of Methylophilus methylotrophus cytochrome c": insights into the structural basis of haem-ligand detachment. J Mol Biol. 2001 Apr 27;308(2):353-65. [PubMed:11327772]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails