3-phosphoshikimate 1-carboxyvinyltransferase

Details

Name
3-phosphoshikimate 1-carboxyvinyltransferase
Synonyms
  • 2.5.1.19
  • 5-enolpyruvylshikimate-3-phosphate synthase
  • EPSP synthase
  • EPSPS
Gene Name
aroA
Organism
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Amino acid sequence
>lcl|BSEQ0011255|3-phosphoshikimate 1-carboxyvinyltransferase
MKLKTNIRHLHGSIRVPGDKSISHRSIIFGSLAEGETKVYDILRGEDVLSTMQVFRDLGV
EIEDKDGVITIQGVGMAGLKAPQNALNMGNSGTSIRLISGVLAGADFEVEMFGDDSLSKR
PMDRVTLPLKKMGVSISGQTERDLPPLRLKGTKNLRPIHYELPIASAQVKSALMFAALQA
KGESVIIEKEYTRNHTEDMLKQFGGHLSVDGKKITVQGPQKLTGQKVVVPGDISSAAFWL
VAGLIAPNSRLVLQNVGINETRTGIIDVIRAMGGKLEITEIDPVAKSATLIVESSDLKGT
EIGGALIPRLIDELPIIALLATQAQGVTVIKDAEELKVKETDRIQVVADALNSMGADITP
TADGMIIKGKSALHGARVNTFGDHRIGMMTAIAALLVADGEVELDRAEAINTSYPSFFDD
LESLIHG
Number of residues
427
Molecular Weight
45765.42
Theoretical pI
6.07
GO Classification
Functions
3-phosphoshikimate 1-carboxyvinyltransferase activity
Processes
aromatic amino acid family biosynthetic process / chorismate biosynthetic process
Components
cytoplasm
General Function
3-phosphoshikimate 1-carboxyvinyltransferase activity
Specific Function
Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011256|3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
ATGAAACTAAAAACAAACATTCGCCATTTACATGGTAGTATCCGCGTCCCAGGTGACAAG
TCTATCAGCCACCGTTCCATTATCTTTGGAAGTTTGGCTGAGGGTGAGACCAAGGTTTAT
GATATTCTGCGAGGTGAAGACGTTCTTTCGACCATGCAGGTTTTTCGTGACCTTGGTGTT
GAAATTGAGGATAAAGATGGGGTTATTACCATTCAAGGTGTAGGCATGGCTGGCTTAAAA
GCGCCACAAAATGCCCTTAATATGGGAAATTCTGGCACCTCGATTCGCCTGATTTCAGGT
GTCCTTGCTGGTGCAGATTTCGAAGTAGAGATGTTTGGAGATGATAGTCTTTCCAAACGT
CCTATGGACCGTGTGACCCTTCCACTGAAAAAAATGGGCGTCAGCATTTCAGGGCAAACT
GAACGAGACTTGCCTCCCCTTCGCTTAAAAGGGACGAAAAACCTAAGACCTATTCATTAT
GAGTTGCCAATTGCCTCTGCCCAAGTCAAGTCAGCCTTGATGTTTGCAGCCTTACAAGCT
AAGGGGGAGTCAGTTATTATCGAAAAAGAGTACACCCGTAATCATACTGAAGATATGTTG
AAACAATTTGGTGGTCATTTAAGTGTGGATGGTAAGAAAATCACAGTCCAGGGGCCACAA
AAATTGACAGGACAGAAGGTGGTCGTACCAGGAGATATTTCCAGTGCAGCCTTTTGGTTA
GTCGCAGGTTTGATTGCTCCAAATTCTCGTCTAGTGCTGCAGAATGTGGGGATCAACGAA
ACTCGCACCGGTATTATTGATGTCATTCGTGCCATGGGTGGAAAATTGGAAATAACTGAA
ATCGATCCAGTCGCTAAATCTGCTACCTTGATTGTTGAGTCTTCTGACTTGAAAGGAACA
GAGATTGGTGGCGCTTTGATTCCACGATTGATTGATGAATTGCCCATTATTGCCCTGCTT
GCGACCCAAGCCCAAGGTGTAACAGTTATCAAGGATGCTGAGGAGCTCAAGGTCAAGGAA
ACAGACCGTATTCAGGTTGTGGCAGACGCCTTAAATAGTATGGGAGCAGATATTACTCCT
ACGGCAGATGGGATGATTATCAAAGGAAAATCAGCTCTTCACGGTGCTAGAGTCAATACG
TTTGGTGACCACCGTATCGGCATGATGACAGCTATCGCAGCCCTCTTGGTTGCAGATGGA
GAGGTGGAGCTTGACCGTGCAGAAGCCATCAATACCAGCTATCCTAGTTTCTTTGATGAT
TTGGAGAGCTTGATTCATGGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9S400
UniProtKB Entry NameAROA_STRPN
GenBank Protein ID5616525
GenBank Gene IDAF169483
General References
  1. Du W, Wallis NG, Mazzulla MJ, Chalker AF, Zhang L, Liu WS, Kallender H, Payne DJ: Characterization of Streptococcus pneumoniae 5-enolpyruvylshikimate 3-phosphate synthase and its activation by univalent cations. Eur J Biochem. 2000 Jan;267(1):222-7. [PubMed:10601870]
  2. Tettelin H, Nelson KE, Paulsen IT, Eisen JA, Read TD, Peterson S, Heidelberg J, DeBoy RT, Haft DH, Dodson RJ, Durkin AS, Gwinn M, Kolonay JF, Nelson WC, Peterson JD, Umayam LA, White O, Salzberg SL, Lewis MR, Radune D, Holtzapple E, Khouri H, Wolf AM, Utterback TR, Hansen CL, McDonald LA, Feldblyum TV, Angiuoli S, Dickinson T, Hickey EK, Holt IE, Loftus BJ, Yang F, Smith HO, Venter JC, Dougherty BA, Morrison DA, Hollingshead SK, Fraser CM: Complete genome sequence of a virulent isolate of Streptococcus pneumoniae. Science. 2001 Jul 20;293(5529):498-506. [PubMed:11463916]
  3. Park H, Hilsenbeck JL, Kim HJ, Shuttleworth WA, Park YH, Evans JN, Kang C: Structural studies of Streptococcus pneumoniae EPSP synthase in unliganded state, tetrahedral intermediate-bound state and S3P-GLP-bound state. Mol Microbiol. 2004 Feb;51(4):963-71. [PubMed:14763973]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04328Shikimate-3-PhosphateexperimentalunknownDetails
DB04539GlyphosateexperimentalunknowninhibitorDetails