Solute carrier family 2, facilitated glucose transporter member 6

Details

Name
Solute carrier family 2, facilitated glucose transporter member 6
Synonyms
  • Glucose transporter type 6
  • Glucose transporter type 9
  • GLUT-6
  • GLUT-9
  • GLUT9
Gene Name
SLC2A6
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008981|Solute carrier family 2, facilitated glucose transporter member 6
MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALERSLDPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSA
AGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFG
SLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT
DVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYI
HFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTG
CCVPETKGRSLEQIESFFRTGRRSFLR
Number of residues
507
Molecular Weight
54538.55
Theoretical pI
Not Available
GO Classification
Functions
glucose transmembrane transporter activity
Processes
glucose transmembrane transport / transmembrane transport
Components
integral component of membrane / membrane / plasma membrane
General Function
Glucose transmembrane transporter activity
Specific Function
Facilitative glucose transporter; binds cytochalasin B with low affinity.
Pfam Domain Function
Transmembrane Regions
38-58 82-102 112-132 141-161 169-189 195-215 290-310 315-335 340-360 396-416 436-456 463-483
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013545|Solute carrier family 2, facilitated glucose transporter member 6 (SLC2A6)
ATGCAGGAGCCGCTGCTGGGAGCCGAGGGCCCGGACTACGACACCTTCCCCGAGAAGCCG
CCCCCGTCGCCAGGGGACAGGGCGCGGGTCGGGACCCTGCAGAACAAAAGGGTGTTCCTG
GCCACCTTCGCCGCAGTGCTCGGCAATTTCAGCTTTGGGTATGCCCTGGTCTACACATCC
CCTGTCATCCCAGCCCTGGAGCGCTCCTTGGATCCTGACCTGCATCTGACCAAATCCCAG
GCATCCTGGTTTGGGTCCGTGTTCACCCTGGGAGCAGCGGCCGGAGGCCTGAGTGCCATG
ATCCTCAACGACCTCCTGGGCCGGAAGCTGAGCATCATGTTCTCAGCTGTGCCGTCGGCG
GCCGGCTATGCGCTCATGGCGGGTGCGCACGGCCTCTGGATGCTGCTGCTCGGAAGGACG
CTGACGGGCTTCGCCGGGGGGCTCACAGCTGCCTGCATCCCGGTGTACGTGTCTGAGATT
GCTCCCCCAGGCGTTCGTGGGGCTCTGGGGGCCACACCCCAGCTCATGGCAGTGTTCGGA
TCCCTGTCCCTCTACGCCCTTGGCCTCCTGCTGCCGTGGCGCTGGCTGGCTGTGGCCGGG
GAGGCGCCTGTGCTCATCATGATCCTGCTGCTCAGCTTCATGCCCAACTCGCCGCGCTTC
CTGCTCTCTCGGGGCAGGGACGAAGAGGCCCTGCGGGCGCTGGCCTGGCTGCGTGGGACG
GACGTCGATGTCCACTGGGAGTTCGAGCAGATCCAGGACAACGTCCGGAGACAGAGCAGC
CGAGTATCGTGGGCTGAGGCACGGGCCCCACACGTGTGCCGGCCCATCACCGTGGCCTTG
CTGATGCGCCTCCTGCAGCAGCTGACGGGCATCACGCCCATCCTGGTCTACCTGCAGTCC
ATCTTCGACAGCACCGCTGTCCTGCTGCCCCCCAAGGACGACGCAGCCATCGTTGGGGCC
GTGCGGCTCCTGTCCGTGCTGATCGCCGCCCTCACCATGGACCTCGCAGGCCGCAAGGTG
CTGCTCTTCGTCTCAGGCTACGCCGTGGGCTGGGGTCCCATCACCTGGCTGCTCATGTCT
GAGGTCCTGCCCCTGCGTGCCCGTGGCGTGGCCTCAGGGCTCTGCGTGCTGGCCAGCTGG
CTCACCGCCTTCGTCCTCACCAAGTCCTTCCTGCCAGTGGTGAGCACCTTCGGCCTCCAG
GTGCCTTTCTTCTTCTTCGCGGCCATCTGCTTGGTGAGCCTGGTGTTCACAGGCTGCTGT
GTGCCCGAGACCAAGGGACGGTCCCTGGAGCAGATCGAGTCCTTCTTCCGCACGGGGAGA
AGGTCCTTCTTGCGCTAG
Chromosome Location
9
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9UGQ3
UniProtKB Entry NameGTR6_HUMAN
HGNC IDHGNC:11011
General References
  1. Doege H, Bocianski A, Joost HG, Schurmann A: Activity and genomic organization of human glucose transporter 9 (GLUT9), a novel member of the family of sugar-transport facilitators predominantly expressed in brain and leucocytes. Biochem J. 2000 Sep 15;350 Pt 3:771-6. [PubMed:10970791]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  7. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09502Fludeoxyglucose (18F)approved, investigationalyessubstrateDetails
DB09341Dextrose, unspecified formapproved, vet_approvedunknownsubstrateDetails
DB01914D-glucoseapproved, investigational, vet_approvednosubstrateDetails