Phosphatidylcholine transfer protein

Details

Name
Phosphatidylcholine transfer protein
Synonyms
  • PC-TP
  • StAR-related lipid transfer protein 2
  • STARD2
  • START domain-containing protein 2
Gene Name
PCTP
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001862|Phosphatidylcholine transfer protein
MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVL
EDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQR
RDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPG
GQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Number of residues
214
Molecular Weight
24843.145
Theoretical pI
5.44
GO Classification
Functions
phosphatidylcholine binding / phosphatidylcholine transporter activity
Processes
cholesterol metabolic process / lipid transport / phospholipid transport
Components
cytosol
General Function
Phosphatidylcholine transporter activity
Specific Function
Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010657|Phosphatidylcholine transfer protein (PCTP)
ATGGACTCAGATTACAGAAAACAATGGGACCAGTATGTTAAAGAACTCTATGAACAAGAA
TGCAACGGAGAGACTGTGGTCTACTGGGAAGTGAAGTACCCTTTTCCCATGTCCAACAGA
GACTATGTCTACCTTCGGCAGCGGCGAGACCTGGACATGGAAGGGAGGAAGATCCATGTG
ATCCTGGCCCGGAGCACCTCCATGCCTCAGCTTGGCGAGAGGTCTGGGGTGATCCGGGTG
AAGCAATACAAGCAGAGCCTGGCGATCGAGAGTGACGGCAAGAAGGGGAGCAAAGTTTTC
ATGTATTACTTCGATAACCCGGGTGGCCAAATTCCGTCCTGGCTCATTAACTGGGCCGCC
AAGAATGGAGTTCCTAACTTCTTGAAAGACATGGCAAGAGCCTGTCAGAACTACCTCAAG
AAAACCTAA
Chromosome Location
17
Locus
17q21-q24
External Identifiers
ResourceLink
UniProtKB IDQ9UKL6
UniProtKB Entry NamePPCT_HUMAN
GenBank Protein ID6049276
GenBank Gene IDAF151638
GenAtlas IDPCTP
HGNC IDHGNC:8752
General References
  1. Cohen DE, Green RM, Wu MK, Beier DR: Cloning, tissue-specific expression, gene structure and chromosomal localization of human phosphatidylcholine transfer protein. Biochim Biophys Acta. 1999 Oct 28;1447(2-3):265-70. [PubMed:10542325]
  2. van Helvoort A, de Brouwer A, Ottenhoff R, Brouwers JF, Wijnholds J, Beijnen JH, Rijneveld A, van der Poll T, van der Valk MA, Majoor D, Voorhout W, Wirtz KW, Elferink RP, Borst P: Mice without phosphatidylcholine transfer protein have no defects in the secretion of phosphatidylcholine into bile or into lung airspaces. Proc Natl Acad Sci U S A. 1999 Sep 28;96(20):11501-6. [PubMed:10500206]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  7. Chan WW, Roderick SL, Cohen DE: Human phosphatidylcholine transfer protein: purification, crystallization and preliminary X-ray diffraction data. Biochim Biophys Acta. 2002 Apr 1;1596(1):1-5. [PubMed:11983415]
  8. Roderick SL, Chan WW, Agate DS, Olsen LR, Vetting MW, Rajashankar KR, Cohen DE: Structure of human phosphatidylcholine transfer protein in complex with its ligand. Nat Struct Biol. 2002 Jul;9(7):507-11. [PubMed:12055623]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02306Palmitoyl-Linoleoyl PhosphatidylcholineexperimentalunknownDetails
DB04372L-DilinoleoyllecithinexperimentalunknownDetails
DB09568Omega-3-carboxylic acidsapproved, investigationalnobinderDetails