Matrix metalloproteinase-17

Details

Name
Matrix metalloproteinase-17
Synonyms
  • 3.4.24.-
  • Membrane-type matrix metalloproteinase 4
  • Membrane-type-4 matrix metalloproteinase
  • MMP-17
  • MT-MMP 4
  • MT4-MMP
  • MT4MMP
  • MTMMP4
Gene Name
MMP17
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037254|Matrix metalloproteinase-17
MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFG
YLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQ
ARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAG
SAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGM
DLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESV
SPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRD
RHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRP
VSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLD
DAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAE
GPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQA
LTL
Number of residues
603
Molecular Weight
66652.23
Theoretical pI
6.55
GO Classification
Functions
calcium ion binding / enzyme activator activity / metalloendopeptidase activity / zinc ion binding
Processes
positive regulation of catalytic activity
Components
anchored component of membrane / integral component of plasma membrane / proteinaceous extracellular matrix
General Function
Zinc ion binding
Specific Function
Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0012570|Matrix metalloproteinase-17 (MMP17)
ATGCGGCGCCGCGCAGCCCGGGGACCCGGCCCGCCGCCCCCAGGGCCCGGACTCTCGCGG
CTGCCGCTGCCGCTGCTGCTGCTGCTGGCGCTGGGGACCCGCGGGGGCTGCGCCGCGCCC
GCACCCGCGCCGCGCGCCGAGGACCTCAGCCTGGGAGTGGAGTGGCTAAGCAGGTTCGGT
TACCTGCCCCCGGCTGACCCCACAACAGGGCAGCTGCAGACGCAAGAGGAGCTGTCTAAG
GCCATCACAGCCATGCAGCAGTTTGGTGGCCTGGAGGCCACCGGCATCCTGGACGAGGCC
ACCCTGGCCCTGATGAAAACCCCACGCTGCTCCCTGCCAGACCTCCCTGTCCTGACCCAG
GCTCGCAGGAGACGCCAGGCTCCAGCCCCCACCAAGTGGAACAAGAGGAACCTGTCGTGG
AGGGTCCGGACGTTCCCACGGGACTCACCACTGGGGCACGACACGGTGCGTGCACTCATG
TACTACGCCCTCAAGGTCTGGAGCGACATTGCGCCCCTGAACTTCCACGAGGTGGCGGGC
AGCGCCGCCGACATCCAGATCGACTTCTCCAAGGCCGACCATAACGACGGCTACCCCTTC
GACGGCCCCGGCGGCACCGTGGCCCACGCCTTCTTCCCCGGCCACCACCACACCGCCGGG
GACACCCACTTTGACGATGACGAGGCCTGGACCTTCCGCTCCTCGGATGCCCACGGGATG
GACCTGTTTGCAGTGGCTGTCCACGAGTTTGGCCACGCCATTGGGTTAAGCCATGTGGCC
GCTGCACACTCCATCATGCGGCCGTACTACCAGGGCCCGGTGGGTGACCCGCTGCGCTAC
GGGCTCCCCTACGAGGACAAGGTGCGCGTCTGGCAGCTGTACGGTGTGCGGGAGTCTGTG
TCTCCCACGGCGCAGCCCGAGGAGCCTCCCCTGCTGCCGGAGCCCCCAGACAACCGGTCC
AGCGCCCCGCCCAGGAAGGACGTGCCCCACAGATGCAGCACTCACTTTGACGCGGTGGCC
CAGATCCGGGGTGAAGCTTTCTTCTTCAAAGGCAAGTACTTCTGGCGGCTGACGCGGGAC
CGGCACCTGGTGTCCCTGCAGCCGGCACAGATGCACCGCTTCTGGCGGGGCCTGCCGCTG
CACCTGGACAGCGTGGACGCCGTGTACGAGCGCACCAGCGACCACAAGATCGTCTTCTTT
AAAGGAGACAGGTACTGGGTGTTCAAGGACAATAACGTAGAGGAAGGATACCCGCGCCCC
GTCTCCGACTTCAGCCTCCCGCCTGGCGGCATCGACGCTGCCTTCTCCTGGGCCCACAAT
GACAGGACTTATTTCTTTAAGGACCAGCTGTACTGGCGCTACGATGACCACACGAGGCAC
ATGGACCCCGGCTACCCCGCCCAGAGCCCCCTGTGGAGGGGTGTCCCCAGCACGCTGGAC
GACGCCATGCGCTGGTCCGACGGTGCCTCCTACTTCTTCCGTGGCCAGGAGTACTGGAAA
GTGCTGGATGGCGAGCTGGAGGTGGCACCCGGGTACCCACAGTCCACGGCCCGGGACTGG
CTGGTGTGTGGAGACTCACAGGCCGATGGATCTGTGGCTGCGGGCGTGGACGCGGCAGAG
GGGCCCCGCGCCCCTCCAGGACAACATGACCAGAGCCGCTCGGAGGACGGTTACGAGGTC
TGCTCATGCACCTCTGGGGCATCCTCTCCCCCGGGGGCCCCAGGCCCACTGGTGGCTGCC
ACCATGCTGCTGCTGCTGCCGCCACTGTCACCAGGCGCCCTGTGGACAGCGGCCCAGGCC
CTGACGCTATGA
Chromosome Location
12
Locus
12q24.3
External Identifiers
ResourceLink
UniProtKB IDQ9ULZ9
UniProtKB Entry NameMMP17_HUMAN
GenBank Protein ID18413635
GenBank Gene IDAB021225
HGNC IDHGNC:7163
General References
  1. Kajita M, Kinoh H, Ito N, Takamura A, Itoh Y, Okada A, Sato H, Seiki M: Human membrane type-4 matrix metalloproteinase (MT4-MMP) is encoded by a novel major transcript: isolation of complementary DNA clones for human and mouse mt4-mmp transcripts. FEBS Lett. 1999 Sep 3;457(3):353-6. [PubMed:10471807]
  2. Puente XS, Pendas AM, Llano E, Velasco G, Lopez-Otin C: Molecular cloning of a novel membrane-type matrix metalloproteinase from a human breast carcinoma. Cancer Res. 1996 Mar 1;56(5):944-9. [PubMed:8640782]
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  4. Wang Y, Johnson AR, Ye QZ, Dyer RD: Catalytic activities and substrate specificity of the human membrane type 4 matrix metalloproteinase catalytic domain. J Biol Chem. 1999 Nov 12;274(46):33043-9. [PubMed:10551873]
  5. Itoh Y, Kajita M, Kinoh H, Mori H, Okada A, Seiki M: Membrane type 4 matrix metalloproteinase (MT4-MMP, MMP-17) is a glycosylphosphatidylinositol-anchored proteinase. J Biol Chem. 1999 Nov 26;274(48):34260-6. [PubMed:10567400]
  6. Kolkenbrock H, Essers L, Ulbrich N, Will H: Biochemical characterization of the catalytic domain of membrane-type 4 matrix metalloproteinase. Biol Chem. 1999 Sep;380(9):1103-8. [PubMed:10543448]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00786MarimastatinvestigationalyesinhibitorDetails