Thymidylate synthase ThyX

Details

Name
Thymidylate synthase ThyX
Synonyms
  • 2.1.1.148
  • thy1
  • TS
Gene Name
thyX
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0020528|Thymidylate synthase ThyX
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHI
VFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTE
KISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQ
WEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV
Number of residues
220
Molecular Weight
26003.785
Theoretical pI
8.38
GO Classification
Functions
flavin adenine dinucleotide binding / thymidylate synthase (FAD) activity
Processes
dTMP biosynthetic process
General Function
Thymidylate synthase (fad) activity
Specific Function
Catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0020529|Thymidylate synthase ThyX (thyX)
ATGAAGATCGATATCTTGGACAAAGGATTCGTTGAACTTGTGGATGTGATGGGAAACGAC
CTCTCCGCTGTACGGGCTGCCCGCGTTTCTTTCGATATGGGTTTGAAAGACGAAGAAAGG
GATAGACATCTCATCGAATATCTCATGAAACACGGTCACGAGACACCTTTCGAACATATT
GTCTTCACTTTCCACGTGAAAGCCCCTATATTCGTGGCGAGGCAGTGGTTCAGACACAGG
ATCGCTTCTTACAACGAACTGAGCGGCAGATACTCGAAGCTCTCCTACGAATTCTACATT
CCCTCTCCCGAACGCCTGGAAGGGTACAAAACGACCATCCCTCCCGAACGGGTGACGGAG
AAGATCTCAGAAATAGTCGATAAAGCGTATCGAACGTATCTGGAGTTGATAGAAAGCGGT
GTTCCTCGAGAAGTGGCAAGGATAGTGCTCCCTTTGAATCTGTACACGAGGTTTTTCTGG
ACTGTGAACGCAAGAAGTCTCATGAACTTTTTGAACCTGAGGGCAGATTCTCACGCTCAG
TGGGAAATTCAACAGTACGCTCTGGCAATCGCGAGAATTTTCAAAGAGAAGTGTCCCTGG
ACTTTTGAGGCATTTCTTAAGTATGCTTATAAAGGAGATATCCTGAAGGAGGTACAGGTA
TGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9WYT0
UniProtKB Entry NameTHYX_THEMA
GenBank Protein ID4980954
GenBank Gene IDAE000512
General References
  1. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]
  2. Kuhn P, Lesley SA, Mathews II, Canaves JM, Brinen LS, Dai X, Deacon AM, Elsliger MA, Eshaghi S, Floyd R, Godzik A, Grittini C, Grzechnik SK, Guda C, Hodgson KO, Jaroszewski L, Karlak C, Klock HE, Koesema E, Kovarik JM, Kreusch AT, McMullan D, McPhillips TM, Miller MA, Miller M, Morse A, Moy K, Ouyang J, Robb A, Rodrigues K, Selby TL, Spraggon G, Stevens RC, Taylor SS, van den Bedem H, Velasquez J, Vincent J, Wang X, West B, Wolf G, Wooley J, Wilson IA: Crystal structure of thy1, a thymidylate synthase complementing protein from Thermotoga maritima at 2.25 A resolution. Proteins. 2002 Oct 1;49(1):142-5. [PubMed:12211025]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB019035-Bromo-2'-deoxyuridine 5'-(dihydrogen phosphate)experimentalunknownDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB037615-fluoro-2'-deoxyuridine-5'-monophosphateexperimentalunknownDetails
DB03800Deoxyuridine monophosphateexperimentalunknownDetails